Tested Applications
| Positive WB detected in | mouse liver tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
25706-1-AP targets C17orf64 in WB, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22769 Product name: Recombinant human C17orf64 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-126 aa of BC048806 Sequence: MLWRFISLFSELEAKQLRRLYKYTKSSQPAKFLVTFCASDAPERSLLADREDSLPKLCHAWGLHSNISGMKERLSNMQTPGQGSPLPGQPRSQDHVKKDSLRELSQKPKLKRKRIKEAPETPETEP Predict reactive species |
| Full Name | chromosome 17 open reading frame 64 |
| Calculated Molecular Weight | 236 aa, 27 kDa |
| Observed Molecular Weight | 27-30 kDa |
| GenBank Accession Number | BC048806 |
| Gene Symbol | C17orf64 |
| Gene ID (NCBI) | 124773 |
| RRID | AB_3669495 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q86WR6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CHCT1 (CHD1 helical C-terminal domain-containing protein 1), also called C17orf64, may play a role in the regulation of apoptosis.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for C17orf64 antibody 25706-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



