C19orf48 Polyclonal antibody

• 

  WB analysis using 30481-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30481-1-AP (C19orf48 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

C19orf48 Polyclonal Antibody for WB, ELISA

Cat No. 30481-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

WB, ELISA

Synonyms

C19orf48

---

Tested Applications

• Positive WB detected in: HT-29 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30481-1-AP targets C19orf48 in WB, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32888

  Product name: Recombinant human C19orf48 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-58 aa of BC006151

  Sequence: MTVLEAVLEIQAITGSRLLSMVPGPARPPGSCWDPTQCTRTWLLSHTPRRRWISGLPR

• Full Name: chromosome 19 open reading frame 48
• Calculated Molecular Weight: 13 kDa
• Observed Molecular Weight: 12-13 kDa
• GenBank Accession Number: BC006151
• Gene Symbol: C19orf48
• Gene ID (NCBI): 84798
• RRID: AB_3669725
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6RUI8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Chromosome 19 open reading frame 48 (C19orf48) plays a crucial role in the development of breast cancer and the overexpression of C19orf48 correlates with poor prognosis in breast cancer. C19orf48 may act as a useful and predictive biomarker for the prognosis of breast cancer. (PMID: 38223642)