C1QA Polyclonal antibody

• 

  WB analysis using 11602-1-AP

  human plasma was subjected to SDS PAGE followed by western blot with 11602-1-AP (C1qA antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human plasma using 11602-1-AP

  human plasma were subjected to SDS PAGE followed by western blot with 11602-1-AP (C1QA antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human spleen using 11602-1-AP

  human spleen tissue were subjected to SDS PAGE followed by western blot with 11602-1-AP (C1QA antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human liver using 11602-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 11602-1-AP (C1QA antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human heart using 11602-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 11602-1-AP (C1QA antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human lung using 11602-1-AP

  human lung tissue were subjected to SDS PAGE followed by western blot with 11602-1-AP (C1QA antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human colon using 11602-1-AP

  human colon tissue were subjected to SDS PAGE followed by western blot with 11602-1-AP (C1QA antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HepG2 using 11602-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using C1QA antibody (11602-1-AP) at dilution of 1:200 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4).

C1QA Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 11602-1-AP

Publications(16)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

Complement C1q A chain

---

Tested Applications

• Positive WB detected in: human plasma, human colon tissue, human heart tissue, human liver tissue, human lung tissue, human spleen tissue
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 14 publications below
• IF: See 6 publications below

Product Information

11602-1-AP targets C1QA in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2141

  Product name: Recombinant human C1QA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-245 aa of BC030153

  Sequence: MEGPRGWLVLCVLAISLASMVTEDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPSA

• Full Name: complement component 1, q subcomponent, A chain
• Calculated Molecular Weight: 245 aa, 26 kDa
• Observed Molecular Weight: 26-30 kDa
• GenBank Accession Number: BC030153
• Gene Symbol: C1QA
• Gene ID (NCBI): 712
• RRID: AB_2067153
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P02745
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The first component of complement, C1, is a calcium-dependent complex of the 3 subcomponents C1q, C1r, and C1s. C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains. Each chain contains a collagen-like region located near the N terminus and a C-terminal globular region. Deficiency of C1q has been associated with lupus erythematosus and glomerulonephritis. This antibody is raised against C1qA which is the A-chain polypeptide of human complement subcomponent C1q.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Brain Behav Immun; PDE4 inhibition alleviates HMGB1/C1q/C3-mediated excessive phagocytic pruning of synapses by microglia and depressive-like behaviors in mice; Authors - Qian Zhao
	WB	Neuron; TREM2-independent microgliosis promotes tau-mediated neurodegeneration in the presence of ApoE4; Authors - Maud Gratuze
	WB	Cell Mol Life Sci; Dietary intake of α-ketoglutarate ameliorates α-synuclein pathology in mouse models of Parkinson's disease; Authors - Wenlong Zhang
	WB	J Neurosci; Immune quiescence of the brain is set by astroglial connexin 43.; Authors - Anne-Cécile Boulay
	WB	Life Sci; Cognitive impairment in Alzheimer's disease FAD4T mouse model: Synaptic loss facilitated by activated microglia via C1qA; Authors - Cui Zhang
human	WB,IF	CNS Neurosci Ther; STING Driving Synaptic Phagocytosis of Hippocampal Microglia/Macrophages Contributes to Cognitive Impairment in Sepsis-Associated Encephalopathy in Mice; Authors - Xin Lv

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Alicia (Verified Customer) (10-07-2025)

Cortical organoid

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Cortical organoid from iPSC control