• Featured Product
  • KD/KO Validated

C1qC Polyclonal antibody

C1qC Polyclonal Antibody for WB, IHC, ELISA
Cat No. 16889-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

C1Q C, Complement C1q C chain, C1QG

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman plasma, mouse serum, rat plasma
Positive IHC detected inhuman liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16889-1-AP targets C1qC in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag10400

Product name: Recombinant human C1QC protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 27-245 aa of BC009016

Sequence: QANTGCYGIPGMPGLPGAPGKDGYDGLPGPKGEPGIPAIPGIRGPKGQKGEPGLPGHPGKNGPMGPPGMPGVPGPMGIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSDSVFSGFLLFPD

Predict reactive species
Full Name complement component 1, q subcomponent, C chain
Calculated Molecular Weight 245 aa, 26 kDa
Observed Molecular Weight 24-26 kDa
GenBank Accession NumberBC009016
Gene Symbol C1QC
Gene ID (NCBI) 714
RRIDAB_2878328
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP02747
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The first component of complement, C1, is a calcium-dependent complex of the 3 subcomponents C1q, C1r, and C1s. C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains. Each chain contains a collagen-like region located near the N terminus and a C-terminal globular region. Deficiency of C1q has been associated with lupus erythematosus and glomerulonephritis. This antibody is raised against C1qC which is the C-chain polypeptide of human complement subcomponent C1q.

Protocols

Product Specific Protocols
IHC protocol for C1qC antibody 16889-1-APDownload protocol
WB protocol for C1qC antibody 16889-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

World J Surg Oncol

Proteomic analysis of small extracellular vesicles from the plasma of patients with hepatocellular carcinoma

Authors - Wei Dong
humanWB

Front Genet

C1QC is a prognostic biomarker with immune-related value in kidney renal clear cell carcinoma

Authors - Wentao Yao
  • KD Validated
humanIHC

J Cancer

Identification of crucial genes through WGCNA in the progression of gastric cancer

Authors - Rui Liu
mouseWB,IF

Mol Neurobiol

Upregulation of C1QC as a Mediator of Blood-Brain Barrier Damage in Type 2 Diabetes Mellitus

Authors - Cheng Huang
humanIHC

Sci Rep

Complement classical and alternative pathway activation contributes to diabetic kidney disease progression: a glomerular proteomics on kidney biopsies

Authors - Yang Yang
Loading...
||
New chat Able
正在加载,请稍候...