C1qC Polyclonal antibody

• Home
• Products
• Primary Antibodies
• C1qC Polyclonal antibody (16889-1-AP)

• Featured Product
• KD/KO Validated

C1qC Polyclonal Antibody for WB, IHC, ELISA

Cat No. 16889-1-AP Copied!

Publications (8)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

C1Q C, Complement C1q C chain, C1QG

• 

  WB analysis using 16889-1-AP

  human plasma was subjected to SDS PAGE followed by western blot with 16889-1-AP (C1qC antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse serum using 16889-1-AP

  mouse serum were subjected to SDS PAGE followed by western blot with 16889-1-AP (C1qC antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 16889-1-AP

  rat plasma was subjected to SDS PAGE followed by western blot with 16889-1-AP (C1qC antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 16889-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 16889-1-AP (C1QC Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 16889-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 16889-1-AP (C1QC Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for C1qC in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human plasma, mouse serum, rat plasma
• Positive IHC detected in: human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16889-1-AP targets C1qC in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10400

  Product name: Recombinant human C1QC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 27-245 aa of BC009016

  Sequence: QANTGCYGIPGMPGLPGAPGKDGYDGLPGPKGEPGIPAIPGIRGPKGQKGEPGLPGHPGKNGPMGPPGMPGVPGPMGIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSDSVFSGFLLFPD

• Full Name: complement component 1, q subcomponent, C chain
• Calculated Molecular Weight: 245 aa, 26 kDa
• Observed Molecular Weight: 24-26 kDa
• GenBank Accession Number: BC009016
• Gene Symbol: C1QC
• Gene ID (NCBI): 714
• RRID: AB_2878328
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P02747
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The first component of complement, C1, is a calcium-dependent complex of the 3 subcomponents C1q, C1r, and C1s. C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains. Each chain contains a collagen-like region located near the N terminus and a C-terminal globular region. Deficiency of C1q has been associated with lupus erythematosus and glomerulonephritis. This antibody is raised against C1qC which is the C-chain polypeptide of human complement subcomponent C1q.

Publications

What published studies show

C1qC Polyclonal antibody (Cat# 16889-1-AP) has 8 citations across journals including Nature Communications, Investigative Ophthalmology & Visual Science, Molecular Neurobiology, Scientific Reports, PLoS Pathogens, Journal of Cancer, Frontiers in Genetics, and World Journal of Surgical Oncology. Research fields span immune heterogeneity and spatial transcriptomics, corneal dystrophy, blood-brain barrier damage in diabetes, diabetic kidney disease, complement activation in infection, gastric cancer, renal cell carcinoma prognosis, and hepatocellular carcinoma exosome proteomics.

Automatically generated from the 8 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Nat Commun; Ultra-precision deconvolution of spatial transcriptomics decodes immune heterogeneity and fate-defining programs in tissues.; Authors - Yin Xu
mouse	WB,IF	Mol Neurobiol; Upregulation of C1QC as a Mediator of Blood-Brain Barrier Damage in Type 2 Diabetes Mellitus; Authors - Cheng Huang
mouse	IF	Invest Ophthalmol Vis Sci; Early Transcriptomic and Pathologic Changes of Col8a2 Mutant Fuchs Endothelial Corneal Dystrophy.; Authors - Xintian Zhao
mouse	IHC	PLoS Pathog; C/EBP-β-regulated complement hyperactivation in spleen of SFTSV-infected mice: A clue to targeted complement therapy.; Authors - Yan Liu
human	IHC	Sci Rep; Complement classical and alternative pathway activation contributes to diabetic kidney disease progression: a glomerular proteomics on kidney biopsies; Authors - Yang Yang
human	IHC	J Cancer; Identification of crucial genes through WGCNA in the progression of gastric cancer; Authors - Rui Liu