C1QTNF2 Recombinant monoclonal antibody, PBS Only (Detector)

C1QTNF2 Uni-rAb® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA

Cat No. 83343-2-PBS
Clone No.240330F8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83343-2-PBS targets C1QTNF2 as part of a matched antibody pair:

MP00385-1: 83343-3-PBS capture and 83343-2-PBS detection (validated in Cytometric bead array)

MP00385-3: 83343-1-PBS capture and 83343-2-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag9183

Product name: Recombinant human C1QTNF2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-325 aa of BC011699

Sequence: LGPTLCPAAAAEESRDAEPRRELLCSGRPWTWRAAARVTTMIPWVLLACALPCAADPLLGAFARRDFRKGSPQLVCSLPGPQGPPGPPGAPGPSGMMGRMGFPGKDGQDGHDGDRGDSGEEGPPGRTGNRGKPGPKGKAGAIGRAGPRGPKGVNGTPGKHGTPGKKGPKGKKGEPGLPGPCSCGSGHTKSAFSVAVTKSYPRERLPIKFDKILMNEGGHYNASSGKFVCGVPGIYYFTYDITLANKHLAIGLVHNGQYRIRTFDANTGNHDVASGSTILALKQGDEVWLQIFYSEQNGLFYDPYWTDSLFTGFLIYADQDDPNEV

Predict reactive species
Full Name C1q and tumor necrosis factor related protein 2
Calculated Molecular Weight 330 aa, 34 kDa
GenBank Accession NumberBC011699
Gene Symbol C1QTNF2
Gene ID (NCBI) 114898
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDA0A499FIM1
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...