RALGAPA2 Polyclonal antibody

• 

  WB analysis using 29843-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29843-1-AP (RALGAPA2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 29843-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29843-1-AP (RALGAPA2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse testis using 29843-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 29843-1-AP (C20orf74 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 29843-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 29843-1-AP (C20orf74 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

RALGAPA2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 29843-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

Human, Mouse and More (1)

Applications

WB, IHC, ELISA

Synonyms

250 kDa substrate of Akt, AS250, bA287B20.1, C20orf74, dJ1049G11, dJ1049G11.4, FLJ12819, KIAA1272, p220, RALGAPA2

---

Tested Applications

• Positive WB detected in: HeLa cells, HUVEC cells, mouse testis tissue
• Positive IHC detected in: mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

29843-1-AP targets RALGAPA2 in WB, IHC, ELISA applications and shows reactivity with Human, Mouse samples.

• Tested Reactivity: Human, Mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31460

  Product name: Recombinant human C20orf74 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1470-1610 aa of NM_020343

  Sequence: YSWDGKVLYGPLEGCLAPNGRNPSFLISSWHRDTFGPQKDSSQVEEGDDVLDKLLENIGHTSPECLLPSQLNLNEPSLTPCGMNYDQEKEIIEVILRQNAQEDEYIQSHNFDSAMKVTSQGQPSPVEPRGPFYFCRLLLDD

• Full Name: chromosome 20 open reading frame 74
• Calculated Molecular Weight: 211KD
• Observed Molecular Weight: 230 kDa
• GenBank Accession Number: NM_020343
• Gene Symbol: RALGAPA2
• Gene ID (NCBI): 57186
• RRID: AB_2923613
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q2PPJ7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Life Sci Alliance; RalGAP complexes control secretion and primary cilia in pancreatic disease; Authors - Lisa H Apken