C3orf43 Polyclonal antibody, PBS Only

• 

  WB analysis of mouse heart using 25362-1-AP (same clone as 25362-1-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 25362-1-AP (C3orf43 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25362-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human plasma using 25362-1-AP (same clone as 25362-1-PBS)

  human plasma were subjected to SDS PAGE followed by western blot with 25362-1-AP (C3orf43 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25362-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 25362-1-AP (same clone as 25362-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using C3orf43 antibody (25362-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 25362-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 25362-1-AP (same clone as 25362-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using C3orf43 antibody (25362-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 25362-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 25362-1-AP (same clone as 25362-1-PBS)

  Immunofluorescent analysis of HeLa cells using 25362-1-AP (C3orf43 antibody) at dilution of 1:25 and Rhodamine-Goat anti-Rabbit IgG. This data was developed using the same antibody clone with 25362-1-PBS in a different storage buffer formulation.

C3orf43 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 25362-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

Single-pass membrane and coiled-coil domain-containing protein 1, Single-pass membrane protein with coiled-coil domains 1, SMCO1

---

Product Information

25362-1-PBS targets C3orf43 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21670

  Product name: Recombinant human C3orf43 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-214 aa of BC118636

  Sequence: MNNETTTLISLKEAMKRVDHKLQALETQFKELDFTKDNLMQKFEHHSKALASQAAQDEMWTAVRALQLTSMELNILYSYVIEVLICLHTRVLEKLPDLVRGLPTLASVLRRKVKNKRVRVVWESILEECGLQEGDITALCTFFIARGNKAEHYTAKVRQMYIRDVTFLITNMVKNQALQDSLLRAVQVIEKGKAVRTPEKQKSSLEELIPSVKN

• Full Name: chromosome 3 open reading frame 43
• Calculated Molecular Weight: 214 aa, 25 kDa
• Observed Molecular Weight: 25-30 kDa
• GenBank Accession Number: BC118636
• Gene Symbol: C3orf43
• Gene ID (NCBI): 255798
• RRID: AB_2880044
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q147U7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.