Product Information
84336-2-PBS targets C5AR1/CD88 in Indirect ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Eg2185 Product name: Recombinant Human C5AR1/CD88 protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 1-37 aa of NM_001736.4 Sequence: MDSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPD Predict reactive species |
Full Name | complement component 5a receptor 1 |
Calculated Molecular Weight | 39kDa |
GenBank Accession Number | NM_001736.4 |
Gene Symbol | C5aR |
Gene ID (NCBI) | 728 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P21730 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |