C7 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• C7 Polyclonal antibody (17642-1-AP)

C7 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 17642-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

complement component 7, Complement component C7

• 

  WB analysis of mouse thymus using 17642-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 17642-1-AP (C7 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human blood using 17642-1-AP

  human blood were subjected to SDS PAGE followed by western blot with 17642-1-AP (C7 Antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse spleen using 17642-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 17642-1-AP (C7 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: mouse thymus tissue, human blood tissue
• Positive IHC detected in: mouse spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17642-1-AP targets C7 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11819

  Product name: Recombinant human C7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 310-690 aa of BC063851

  Sequence: GGEYRVLFYVDSEKLKQNDFNSVEEKKCKSSGWHFVVKFSSHGCKELENALKAASGTQNNVLRGEPFIRGGGAGFISGLSYLELDNPAGNKRRYSAWAESVTNLPQVIKQKLTPLYELVKEVPCASVKKLYLKWALEEYLDEFDPCHCRPCQNGGLATVEGTHCLCHCKPYTFGAACEQGVLVGNQAGGVDGGWSCWSSWSPCVQGKKTRSRECNNPPPSGGGRSCVGETTESTQCEDEELEHLRLLEPHCFPLSLVPTEFCPSPPALKDGFVQDEGTMFPVGKNVVYTCNEGYSLIGNPVARCGEDLRWLVGEMHCQKIACVLPVLMDGIQSHPQKPFYTVGEKVTVSCSGGMSLEGPSAFLCGSSLKWSPEMKNARCVQ

• Full Name: complement component 7
• Calculated Molecular Weight: 843 aa, 94 kDa
• Observed Molecular Weight: 105 kDa
• GenBank Accession Number: BC063851
• Gene Symbol: C7
• Gene ID (NCBI): 730
• RRID: AB_1959350
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P10643
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The complement system is an important effector that bridges the innate and adaptive immune systems (PMID: 20010915). Complement component 7 (C7) is a single-chain plasma glycoprotein that is the final product of the complement cascade and plays a central role in the activation of the complement system. It is a constituent of the membrane attack complex (MAC) that plays a key role in the innate and adaptive immune response by forming pores in the plasma membrane of target cells (PMID: 10886232; PMID: 27852032). C7 is a potential tumor suppressor and a prognostic biomarker for prostate cancer and renal cell carcinoma (PMID: 32984006; PMID: 33158953). C7 serves as a membrane anchor. People with C7 deficiency are prone to bacterial infection (PMID: 19758139).

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cell Proteomics; Proteomic landscape of exosomes reveals the functional contributions of CD151 in triple-negative breast cancer.; Authors - Sipeng Li
human	WB	Ann Clin Transl Neurol; Plasma EV Proteomics Identifies ECM Remodeling and Inflammatory Proteins LUM and C7 as Candidate Biomarkers in FSHD.; Authors - Mustafa Bilal Bayazit
human	WB,IHC	Mol Cell Proteomics; Proteomic analysis of human follicular fluid-derived exosomes reveals that insufficient folliculogenesis in aging women is associated with infertility; Authors - Zhen Liu