CA5B Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86996-1-RR (same clone as 86996-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86996-1-RR (CA5B antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86996-1-PBS in a different storage buffer formulation.

CA5B Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86996-1-PBS

Clone No.251915F10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

CA VB, Carbonic Anhydrase 5B, Carbonic Anhydrase 5B/CA5B, CAVB, CA-VB

---

Product Information

86996-1-PBS targets CA5B in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag4166

  Product name: Recombinant human CA5B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-317 aa of BC028142

  Sequence: MVVMNSLRVILQASPGKLLWRKFQIPRFMPARPCSLYTCTYKTRNRALHPLWESVDLVPGGDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPLEHNYRLKQFHFHWGAIDAWGSEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDYVLNVQAKPKPATSQATP

• Full Name: carbonic anhydrase VB, mitochondrial
• Calculated Molecular Weight: 317 aa, 36 kDa
• Observed Molecular Weight: 32-35 kDa
• GenBank Accession Number: BC028142
• Gene Symbol: CA5B
• Gene ID (NCBI): 11238
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9Y2D0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CA5B(Carbonic anhydrase 5B, mitochondrial) is also named as CA-VB and belongs to the alpha-carbonic anhydrase family.CA5B encodes a 317-amino acid protein that has 64% sequence similarity with CA5 (114761), a mitochondrial CA, and contains a 33-amino-acid residue signal sequence. Western blot analysis revealed a 36-kD protein precursor and a 32-kD mature protein (PMID:10409679).