CACNA1A Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CACNA1A Polyclonal antibody (27227-1-AP)

CACNA1A Polyclonal Antibody for IHC, ELISA

Cat No. 27227-1-AP

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

APCA, BI, Brain calcium channel I, CACH4, CACN3, CACNA1A, CACNL1A4, CAV2.1, EA2, FHM, HPCA, MHP, MHP1, SCA6

• 

  IHC staining of human brain using 27227-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 27227-1-AP (CACNA1A Antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 27227-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 27227-1-AP (CACNA1A Antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive IHC detected in: human brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27227-1-AP targets CACNA1A in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25943

  Product name: Recombinant human CACNA1A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 821-920 aa of NM_000068

  Sequence: MDRPLVVDPQENRNNNTNKSRAAEPTVDQRLGQQRAEDFLRKQARYHDRARDPSGSAGLDARRPWAGSQEAELSREGPYGRESDHHAREGSLEQPGFWEGE

• Full Name: calcium channel, voltage-dependent, P/Q type, alpha 1A subunit
• Calculated Molecular Weight: 282 kDa
• GenBank Accession Number: NM_000068
• Gene Symbol: CACNA1A
• Gene ID (NCBI): 773
• RRID: AB_2880810
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00555
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Reviews

5.0 out of 5

2 verified customer reviews

What customers say

Automatically generated from the verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Lea (Verified Customer) (10-08-2024)

I transfected HEK 293T cells with 2 different CACNA1A constructs (12Q and 27Q, 2 replicates each) and an empty vector as a negative control. The expected band at ~280 kDa is clearly visible in the western blot and no unspecific bands are visible in the negative control. I was very happy with the results.

• Applications: Western Blot
• Primary Antibody Dilution: 1:5000
• Cell Tissue Type: HEK 293T

CACNA1A Antibody Western Blot validation (1:5000 dilution) in HEK 293T (Cat no:27227-1-AP)

Ümit (Verified Customer) (08-11-2022)

Cav2.1 (black) staining of two rhesus monkey brainstem sections (5µm &7µm) visualized with immunoperoxidase method (DAB-Nickel).

• Applications: Immunohistochemistry
• Primary Antibody Dilution: 1:100
• Cell Tissue Type: Monkey/Purkinje Cells

CACNA1A Antibody Immunohistochemistry validation (1:100 dilution) in Monkey/Purkinje Cells (Cat no:27227-1-AP)