CACNA1A Polyclonal antibody

• 

  IHC staining of human brain using 27227-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 27227-1-AP (CACNA1A Antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human brain using 27227-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 27227-1-AP (CACNA1A Antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CACNA1A Polyclonal Antibody for IHC, ELISA

Cat No. 27227-1-AP

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

APCA, BI, Brain calcium channel I, CACH4, CACN3, CACNA1A, CACNL1A4, CAV2.1, EA2, FHM, HPCA, MHP, MHP1, SCA6

---

Tested Applications

• Positive IHC detected in: human brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27227-1-AP targets CACNA1A in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25943

  Product name: Recombinant human CACNA1A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 821-920 aa of NM_000068

  Sequence: MDRPLVVDPQENRNNNTNKSRAAEPTVDQRLGQQRAEDFLRKQARYHDRARDPSGSAGLDARRPWAGSQEAELSREGPYGRESDHHAREGSLEQPGFWEGE

• Full Name: calcium channel, voltage-dependent, P/Q type, alpha 1A subunit
• Calculated Molecular Weight: 282 kDa
• GenBank Accession Number: NM_000068
• Gene Symbol: CACNA1A
• Gene ID (NCBI): 773
• RRID: AB_2880810
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00555
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Lea (Verified Customer) (10-08-2024)

I transfected HEK 293T cells with 2 different CACNA1A constructs (12Q and 27Q, 2 replicates each) and an empty vector as a negative control. The expected band at ~280 kDa is clearly visible in the western blot and no unspecific bands are visible in the negative control. I was very happy with the results.

• Applications: Western Blot
• Primary Antibody Dilution: 1:5000
• Cell Tissue Type: HEK 293T

CACNA1A Antibody Western Blot validation (1:5000 dilution) in HEK 293T (Cat no:27227-1-AP)

FH

Ümit (Verified Customer) (08-11-2022)

Cav2.1 (black) staining of two rhesus monkey brainstem sections (5µm &7µm) visualized with immunoperoxidase method (DAB-Nickel).

• Applications: Immunohistochemistry
• Primary Antibody Dilution: 1:100
• Cell Tissue Type: Monkey/Purkinje Cells

CACNA1A Antibody Immunohistochemistry validation (1:100 dilution) in Monkey/Purkinje Cells (Cat no:27227-1-AP)