Use Able AI chat for product recommendations

CACNA1A Polyclonal antibody

CACNA1A Polyclonal Antibody for IHC, ELISA

Cat No. 27227-1-AP
Reviews (2)
Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

APCA, BI, Brain calcium channel I, CACH4, CACN3, CACNA1A, CACNL1A4, CAV2.1, EA2, FHM, HPCA, MHP, MHP1, SCA6

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for CACNA1A in ?

Tested Applications

Positive IHC detected inhuman brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

27227-1-AP targets CACNA1A in IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25943

Product name: Recombinant human CACNA1A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 821-920 aa of NM_000068

Sequence: MDRPLVVDPQENRNNNTNKSRAAEPTVDQRLGQQRAEDFLRKQARYHDRARDPSGSAGLDARRPWAGSQEAELSREGPYGRESDHHAREGSLEQPGFWEGE

Predict reactive species
Full Name calcium channel, voltage-dependent, P/Q type, alpha 1A subunit
Calculated Molecular Weight 282 kDa
GenBank Accession NumberNM_000068
Gene Symbol CACNA1A
Gene ID (NCBI) 773
RRIDAB_2880810
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO00555
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for CACNA1A antibody 27227-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

    5.0 out of 5
Add a review

2 verified customer reviews

What customers say

Both reviewers gave 5-star ratings. One used the antibody for Western Blot on HEK 293T cells transfected with CACNA1A constructs at a 1:5000 dilution, reporting a clear ~280 kDa band with no unspecific signals in the negative control. The other applied it for Immunohistochemistry on rhesus monkey brainstem sections at 1:100 dilution, successfully visualizing Cav2.1 staining in Purkinje cells using the immunoperoxidase method (DAB-Nickel). Overall, users report strong specificity and reliable performance across applications.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Lea (Verified Customer) (10-08-2024)

I transfected HEK 293T cells with 2 different CACNA1A constructs (12Q and 27Q, 2 replicates each) and an empty vector as a negative control. The expected band at ~280 kDa is clearly visible in the western blot and no unspecific bands are visible in the negative control. I was very happy with the results.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: HEK 293T
CACNA1A Antibody Western Blot validation (1:5000 dilution) in HEK 293T (Cat no:27227-1-AP)

Ümit (Verified Customer) (08-11-2022)

Cav2.1 (black) staining of two rhesus monkey brainstem sections (5µm &7µm) visualized with immunoperoxidase method (DAB-Nickel).

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Monkey/Purkinje Cells
CACNA1A Antibody Immunohistochemistry validation (1:100 dilution) in Monkey/Purkinje Cells (Cat no:27227-1-AP)
Loading...
||
New chat

Able™

正在加载,请稍候...