Tested Applications
| Positive IHC detected in | human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27227-1-AP targets CACNA1A in IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25943 Product name: Recombinant human CACNA1A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 821-920 aa of NM_000068 Sequence: MDRPLVVDPQENRNNNTNKSRAAEPTVDQRLGQQRAEDFLRKQARYHDRARDPSGSAGLDARRPWAGSQEAELSREGPYGRESDHHAREGSLEQPGFWEGE Predict reactive species |
| Full Name | calcium channel, voltage-dependent, P/Q type, alpha 1A subunit |
| Calculated Molecular Weight | 282 kDa |
| GenBank Accession Number | NM_000068 |
| Gene Symbol | CACNA1A |
| Gene ID (NCBI) | 773 |
| RRID | AB_2880810 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O00555 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for CACNA1A antibody 27227-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Reviews
What customers say
Both reviewers gave 5-star ratings. One used the antibody for Western Blot on HEK 293T cells transfected with CACNA1A constructs at a 1:5000 dilution, reporting a clear ~280 kDa band with no unspecific signals in the negative control. The other applied it for Immunohistochemistry on rhesus monkey brainstem sections at 1:100 dilution, successfully visualizing Cav2.1 staining in Purkinje cells using the immunoperoxidase method (DAB-Nickel). Overall, users report strong specificity and reliable performance across applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Lea (Verified Customer) (10-08-2024) | I transfected HEK 293T cells with 2 different CACNA1A constructs (12Q and 27Q, 2 replicates each) and an empty vector as a negative control. The expected band at ~280 kDa is clearly visible in the western blot and no unspecific bands are visible in the negative control. I was very happy with the results.
 |
Ümit (Verified Customer) (08-11-2022) | Cav2.1 (black) staining of two rhesus monkey brainstem sections (5µm &7µm) visualized with immunoperoxidase method (DAB-Nickel).
 |
