CAMLG Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CAMLG Polyclonal antibody (23327-1-AP)

CAMLG Polyclonal Antibody for WB, IHC, ELISA

Cat No. 23327-1-AP Copied!

Reviews (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

calcium modulating ligand, Calcium signal-modulating cyclophilin ligand, CAML, GET2, Guided entry of tail-anchored proteins factor CAMLG

• 

  WB analysis using 23327-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 23327-1-AP (CAMLG antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 23327-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 23327-1-AP (CAMLG antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human testis using 23327-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 23327-1-AP (CAMLG antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse testis using 23327-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 23327-1-AP (CAMLG antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 23327-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 23327-1-AP (CAMLG Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 23327-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 23327-1-AP (CAMLG Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CAMLG in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: SH-SY5Y cells, human testis tissue, Jurkat cells, mouse testis tissue, U-87 MG cells, mouse brain tissue, rat brain tissue
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

23327-1-AP targets CAMLG in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19915

  Product name: Recombinant human CAMLG protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-184 aa of BC130325

  Sequence: MESMAVATDGGERPGVPAGSGLSASQRRAELRRRKLLMNSEQRINRIMGFHRPGSGAEEESQTKSKQQDSDKLNSLSVPSVSKRVVLGDSVSTGTTDQQGGVAEVKGTQLGDKLDSFIKPPECSSDVNLELRQRNRGDLTADSVQRGSRHGLEQYLSRFEEAMKLRKQLISEKPSQEDGNTTEE

• Full Name: calcium modulating ligand
• Calculated Molecular Weight: 296 aa, 33 kDa
• Observed Molecular Weight: 36 kDa
• GenBank Accession Number: BC130325
• Gene Symbol: CAMLG
• Gene ID (NCBI): 819
• RRID: AB_2879256
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P49069
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Reviews

4.0 out of 5

1 verified customer reviews

What customers say

One reviewer (Wei Feng, June 2020) rated this product 4 out of 5 stars. They used it for Western Blot on mouse heart tissue and reported a sharp band at the predicted size, indicating good specificity and performance for their application.

Automatically generated from the 1 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

WEI (Verified Customer) (06-28-2020)

Sharp band at predicted size.

• Applications: Western Blot,
• Cell Tissue Type: Mouse Heart