CAMP Polyclonal antibody

• 

  WB analysis using 12009-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12009-1-AP (CAMP antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse spleen using 12009-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 12009-1-AP (CAMP antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 12009-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 12009-1-AP (CAMP antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 12009-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 12009-1-AP (CAMP antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 12009-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 12009-1-AP (CAMP antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 12009-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 12009-1-AP (CAMP antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 12009-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 12009-1-AP (CAMP antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human spleen using 12009-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 12009-1-AP (CAMP Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human spleen using 12009-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 12009-1-AP (CAMP Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human tonsillitis using 12009-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 12009-1-AP (CAMP antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 12009-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 12009-1-AP (CAMP antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse liver using 12009-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse liver tissue using CAMP antibody (12009-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of rat liver using 12009-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat liver tissue using CAMP antibody (12009-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 12009-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using CAMP antibody (12009-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of THP-1 using 12009-1-AP

  Immunofluorescent analysis of (4% PFA) fixed THP-1 cells using CAMP antibody (12009-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

CAMP Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA

Cat No. 12009-1-AP

Publications(13)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, IF-P, ELISA

Synonyms

CAP18, Antibacterial peptide FALL-39, Antibacterial peptide FF-33, Antibacterial peptide KR-20, Antibacterial peptide KS-30

---

Tested Applications

• Positive WB detected in: human plasma, mouse spleen tissue
• Positive IHC detected in: mouse spleen tissue, human lung cancer tissue, human spleen tissue, human tonsillitis tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: rat liver tissue, mouse liver tissue
• Positive IF/ICC detected in: HeLa cells, THP-1 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 10 publications below
• IHC: See 3 publications below
• IF: See 2 publications below

Product Information

12009-1-AP targets CAMP in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2622

  Product name: Recombinant human CAMP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-170 aa of BC055089

  Sequence: MKTQRDGHSLGRWSLVLLLLGLVMPLAIIAQVLSYKEAVLRAIDGINQRSSDANLYRLLDLDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

• Full Name: cathelicidin antimicrobial peptide
• Calculated Molecular Weight: 170 aa, 19 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC055089
• Gene Symbol: CAMP
• Gene ID (NCBI): 820
• RRID: AB_908736
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P49913
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CAMP is a member of an antimicrobial peptide family, characterized by a highly conserved N-terminal signal peptide containing a cathelin domain and a structurally variable cationic antimicrobial peptide, which is produced by extracellular proteolysis from the C-terminus. In addition to its antibacterial, antifungal, and antiviral activities, the encoded protein functions in cell chemotaxis, immune mediator induction, and inflammatory response regulation. CAMP encodes the 18-kDa proprotein hCAP18. FALL-39 and LL-37 are the mature cathelicidin peptides. This antibody can recognize all the proprotein and cleaved species.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	EMBO Mol Med; Gut microbiota-CRAMP axis shapes intestinal barrier function and immune responses in dietary gluten-induced enteropathy.; Authors - Zhengnan Ren
Rat	WB,IHC	Digestion; Hesperidin Improves Colonic Motility in Loeramide-Induced Constipation Rat Model via 5-Hydroxytryptamine 4R/cAMP Signaling Pathway.; Authors - Minna Wu
mouse	WB	Pharm Biol; Modified BuShenYiQi formula alleviates experimental allergic asthma in mice by negative regulation of type 2 innate lymphoid cells and CD4 + type 9 helper T cells and the VIP-VPAC2 signalling pathway; Authors - Muhua Huang
rat	WB	Sci Prog; Ginsenoside Rg1 exerts anti-arrhythmic effect by inhibiting ICaL through cAMP-PKA and PI3K-AKT signaling pathways in rat ventricular myocytes after myocardial ischemia-reperfusion injury; Authors - Teng Wang
mouse	IHC	Immunobiology; IL-33 synergistically promotes the proliferation of lung cancer cells in vitro by inducing antibacterial peptide LL-37 and proinflammatory cytokines in macrophages.; Authors - Yinting Jiang
mouse	WB	Res Vet Sci; Proteomic analysis of murine bone marrow derived dendritic cells in response to peste des petits ruminants virus.; Authors - Lingxia Li