Recombinant human CAMP protein
Source
e coli.-derived, PET28a
Tag
6*His
Format
Liquid
Cat no : Ag28639
Synonyms
CAMP, CAP18, Antibacterial peptide FALL-39, Antibacterial peptide FF-33, Antibacterial peptide KR-20
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MKTQRDGHSLGRWSLVLLLLGLVMPLAIIAQVLSYKEAVLRAIDGINQRSSDANLYRLLDLDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
(1-170 aa encoded by BC055089) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
