Calpain 3 Polyclonal antibody, PBS Only

• 

  WB analysis using 28476-1-AP (same clone as 28476-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28476-1-AP (Calpain 3 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28476-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 28476-1-AP (same clone as 28476-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 28476-1-AP (CAPN3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28476-1-PBS in a different storage buffer formulation.

Calpain 3 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 28476-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

CAPN3, Calcium-activated neutral proteinase 3, calpain 3, (p94), Calpain L3, Calpain p94

---

Product Information

28476-1-PBS targets Calpain 3 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29454

  Product name: Recombinant human CAPN3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 488-666 aa of BC146672

  Sequence: NRRKDRKLGASLFTIGFAIYEVPKEMHGNKQHLQKDFFLYNASKARSKTYINMREVSQRFRLPPSEYVIVPSTYEPHQEGEFILRVFSEKRNLSEEVENTISVDRPVKKKKTKPIIFVSDRANSNKELGVDQESEEGKGKTSPDKQKQSPQPQPGSSDQESEEQQQFRNIFKQIAGDDM

• Full Name: calpain 3, (p94)
• Observed Molecular Weight: 90-105 kDa, 55-60 kDa
• GenBank Accession Number: BC146672
• Gene Symbol: CAPN3
• Gene ID (NCBI): 825
• RRID: AB_2881150
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P20807
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Calpain 3 (CAPN3), a major intracellular protease, is a muscle-specific member of the calpain large subunit family that specifically binds to titin. CAPN3 plays a role in the dysferlin protein complex and that disruption of CAPN3 function may affect muscle membrane repair and remodeling. CAPN3 has some isoforms with MW of 94, 84, 93, 36, 18 kDa. CAPN3 autolysis generates a small N-terminal fragment of 34 kDa and a large C-terminal fragment whose size ranges from 55 to 60 kDa during self-processing (PMID: 9794799, 14645524).