Caveolin-1 Polyclonal antibody

• 

Caveolin-1 Polyclonal Antibody for ELISA

Cat No. 16446-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

---

Published Applications

• WB: See 3 publications below

Product Information

16446-1-AP targets Caveolin-1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10924

  Product name: Recombinant human CAV1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-101 aa of BC009685

  Sequence: MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYR

• Full Name: caveolin 1, caveolae protein, 22kDa
• Calculated Molecular Weight: 22 kDa
• GenBank Accession Number: BC006432
• Gene Symbol: CAV1
• Gene ID (NCBI): 857
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q03135
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Phytomedicine; Escin avoids hemorrhagic transformation in ischemic stroke by protecting BBB through the AMPK/Cav-1/MMP-9 pathway; Authors - Xiaohui Sun
mouse	WB	J Agric Food Chem; Phenolic Glycosides from the Roots of Ficus hirta Vahl. and Their Antineuroinflammatory Activities.; Authors - Xiansheng Ye
human	WB	Sci Adv; Modulation of blood-tumor barrier transcriptional programs improves intratumoral drug delivery and potentiates chemotherapy in GBM; Authors - Jorge L Jimenez-Macias