Filter: AllWBIPIHC

WB analysis of HeLa using 16447-1-AP
WB result of Caveolin-1 antibody (16447-1-AP; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Caveolin-1 transfected HeLa cells.
WB analysis using 16447-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 16447-1-AP (Caveolin-1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.
WB analysis using 16447-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 16447-1-AP (Caveolin-1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
IP experiment of A549 using 16447-1-AP
IP result of anti-Caveolin-1 (IP:16447-1-AP, 3ug; Detection:16447-1-AP 1:500) with A549 cells lysate 1200ug.
IHC staining of human breast cancer using 16447-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 16447-1-AP (Caveolin-1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of mouse brain using 16447-1-AP
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 16447-1-AP (Caveolin-1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of mouse kidney using 16447-1-AP
Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 16447-1-AP (Caveolin-1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of mouse brain using 16447-1-AP
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 16447-1-AP (Caveolin-1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human lung using 16447-1-AP
Immunohistochemical analysis of paraffin-embedded human lung using 16447-1-AP (CAV1 antibody) at dilution of 1:50 (under 10x lens).
IHC staining of human lung using 16447-1-AP
Immunohistochemical analysis of paraffin-embedded human lung using 16447-1-AP (CAV1 antibody) at dilution of 1:50 (under 40x lens).
IHC staining of human heart using 16447-1-AP
Immunohistochemical analysis of paraffin-embedded human heart using 16447-1-AP (CAV1 antibody) at dilution of 1:50 (under 10x lens).
IHC staining of human heart using 16447-1-AP
Immunohistochemical analysis of paraffin-embedded human heart using 16447-1-AP (CAV1 antibody) at dilution of 1:50 (under 40x lens).
IHC staining of human liver using 16447-1-AP
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 16447-1-AP (Caveolin-1 antibody) at dilution of 1:200 (under 10x lens).
IHC staining of human liver using 16447-1-AP
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 16447-1-AP (Caveolin-1 antibody) at dilution of 1:200 (under 40x lens).
IHC staining of human lung cancer using 16447-1-AP
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 16447-1-AP (Caveolin-1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human lung cancer using 16447-1-AP
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 16447-1-AP (Caveolin-1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Featured Product
KD/KO Validated

Caveolin-1 Polyclonal antibody

Name: Caveolin-1 Polyclonal antibody
Brand: Proteintech
SKU: 16447-1-AP
Rating: 4.43 (7 reviews)

Caveolin-1 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 16447-1-AP

Publications(109)

Reviews (7)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (4)

Applications

WB, IHC, IF, IP, CoIP, ELISA

Synonyms

Caveolin 1, CAV1, MSTP085, CGL3, CAV

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information
Publications (109)
Protocols
Reviews (7)

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	A549 cells, HeLa cells, NIH/3T3 cells
Positive IP detected in	A549 cells
Positive IHC detected in	human breast cancer tissue, human lung tissue, human heart tissue, human liver tissue, human lung cancer tissue, mouse brain tissue, mouse kidney tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:1000-1:8000
Immunoprecipitation (IP)	IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)	IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

KD/KO	See 14 publications below
WB	See 88 publications below
IHC	See 18 publications below
IF	See 25 publications below
IP	See 4 publications below
CoIP	See 2 publications below

Product Information

16447-1-AP targets Caveolin-1 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human, mouse, rat, canine, monkey, zebrafish, bovine
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag8049 Product name: Recombinant human Caveolin-1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 11-179 aa of BC006432 Sequence: GHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI Predict reactive species
Full Name	caveolin 1, caveolae protein, 22kDa
Calculated Molecular Weight	22 kDa
Observed Molecular Weight	20-25 kDa
GenBank Accession Number	BC006432
Gene Symbol	CAV1
Gene ID (NCBI)	857
RRID	AB_10732595
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q03135
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Caveolin-1 (CAV1), a multifunctional protein, is the main constituent molecule of caveolae and represents a scaffolding molecule for several signaling molecules including epidermal growth factor receptor (PMID: 19641024). Several studies have implicated that a reduced expression of CAV1 was found in cancers including head and neck carcinoma (PMID: 19002186). However, other studies recognize CAV1 as a tumor promoter because CAV1 is overexpressed in various kinds of cancers, especially in oral cancer (PMID: 20558341). Recent study also show that CAV1 is involved in astric Cancer (PMID: 25339030). MW of Caveolin-1 is from 20-25 kDa due to phosphorylation (PMID: 10198051).

Protocols

Product Specific Protocols
IHC protocol for Caveolin-1 antibody 16447-1-AP	Download protocol
IP protocol for Caveolin-1 antibody 16447-1-AP	Download protocol
WB protocol for Caveolin-1 antibody 16447-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

Species	Application	Title
human	WB	Cell Res RAB31 marks and controls an ESCRT-independent exosome pathway. Authors - Denghui Wei View Article
human	WB	Nucleic Acids Res Nucleosomes enter cells by clathrin- and caveolin-dependent endocytosis. Authors - Huawei Wang View Article
mouse	WB	Dev Cell Vangl2 limits chaperone-mediated autophagy to balance osteogenic differentiation in mesenchymal stem cells. Authors - Yan Gong View Article
human,mouse	WB,IF	Redox Biol Selenoprotein K contributes to CD36 subcellular trafficking in hepatocytes by accelerating nascent COPII vesicle formation and aggravates hepatic steatosis Authors - Mengyue You View Article
mouse	WB	Biomaterials Combination antitumor immunotherapy with VEGF and PIGF siRNA via systemic delivery of multi-functionalized nanoparticles to tumor-associated macrophages and breast cancer cells. Authors - Yudong Song View Article
human	IF	Small Smart Carbon Nanotubes with Laser-Controlled Behavior in Gene Delivery and Therapy through a Non-Digestive Trafficking Pathway. Authors - Fenfen Kong View Article

Reviews

Add a review

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

FH Sammy (Verified Customer) (01-20-2024)	Excellent antibody for use by western blotting. Diluted in 3% BSA PBST. Applications: Western Blot Primary Antibody Dilution: 1 in 1000 Cell Tissue Type: HUVEC Caveolin-1 Antibody Western Blot validation (1 in 1000 dilution) in HUVEC (Cat no:16447-1-AP)
FH Priya (Verified Customer) (06-21-2023)	Used this antibody for Caco2 cells andmice tissue Applications: Western Blot Primary Antibody Dilution: 1 to 1000 Cell Tissue Type: Caco2, Mice colon
FH Priya (Verified Customer) (06-21-2023)	Used this antibody for Caco2 cells andmice tissue Applications: Western Blot Primary Antibody Dilution: 1 to 1000 Cell Tissue Type: Caco2, Mice colon
FH Priya (Verified Customer) (04-17-2023)	Used for Caco2 cells Applications: Western Blot Primary Antibody Dilution: 1 to 2000 Cell Tissue Type: Caco2, Mice colon
FH Priya (Verified Customer) (04-17-2023)	Used for Caco2 cells Applications: Western Blot Primary Antibody Dilution: 1 to 2000 Cell Tissue Type: Caco2, Mice colon
FH Emma (Verified Customer) (03-15-2022)	Works really well @ 1:1000 for WB in PC3 and DU145 cells. Single band seen. Applications: Western Blot Primary Antibody Dilution: 1:1000 Cell Tissue Type: Prostate
FH Kushal (Verified Customer) (08-09-2021)	We tried to use the antibody at high concentrations of 1:100, yet we do not get bands in our blots. Applications: Western Blot Primary Antibody Dilution: 1:100 Cell Tissue Type: Caco-2