Tested Applications
| Positive WB detected in | A549 cells, HeLa cells, A431 cells, PC-3 cells, human heart tissue, pig heart tissue, Rat heart tissue, mouse heart tissue |
| Positive IHC detected in | human ovary tumor tissue, human breast cancer tissue, human liver tissue, human ovary cancer tissue, human placenta tissue, human tonsillitis tissue, human lung tissue, human appendicitis tissue, human stomach cancer tissue, human spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human liver cancer tissue, mouse kidney tissue, human skin cancer tissue |
| Positive IF/ICC detected in | A549 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:2000-1:8000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66067-1-Ig targets Caveolin-1 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human, mouse, rat, pig, canine, monkey, chicken, sheep |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8049 Product name: Recombinant human Caveolin-1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 11-179 aa of BC006432 Sequence: GHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI Predict reactive species |
| Full Name | caveolin 1, caveolae protein, 22kDa |
| Calculated Molecular Weight | 22 kDa |
| Observed Molecular Weight | 20-25 kDa |
| GenBank Accession Number | BC006432 |
| Gene Symbol | CAV1 |
| Gene ID (NCBI) | 857 |
| RRID | AB_11043343 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q03135 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Caveolin-1 (CAV1), a multifunctional protein, is the main constituent molecule of caveolae and represents a scaffolding molecule for several signaling molecules including epidermal growth factor receptor (PMID: 19641024). Several studies have implicated that a reduced expression of CAV1 was found in cancers including head and neck carcinoma (PMID: 19002186). However, other studies recognize CAV1 as a tumor promoter because CAV1 is overexpressed in various kinds of cancers, especially in oral cancer (PMID: 20558341). Recent study also show that CAV1 is involved in gastric Cancer (PMID: 25339030).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Caveolin-1 antibody 66067-1-Ig | Download protocol |
| IHC protocol for Caveolin-1 antibody 66067-1-Ig | Download protocol |
| WB protocol for Caveolin-1 antibody 66067-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-Caveolin-1 (CAV1) antibody (Cat# 66067-1-Ig) has accumulated 34 citations across journals including Nature Communications, Cancer Research, Advanced Science, Cell Death & Disease, Redox Biology, FASEB Journal, and Communications Biology. Research fields span oncology (hepatocellular, pancreatic, breast, gastric cancers), cardiovascular biology, metabolic disorders (insulin resistance, obesity), ferroptosis, neurodegeneration (Alzheimer's disease), barrier integrity (tight junctions, blood–brain barrier), and veterinary medicine. Applications include WB, IF, IHC, and IP.
| Species | Application | Title |
|---|---|---|
Cancer Res Inhibition of EGFR Overcomes Acquired Lenvatinib Resistance Driven by STAT3-ABCB1 Signaling in Hepatocellular Carcinoma | ||
Nat Commun Endothelial discoidin domain receptor 1 senses flow to modulate YAP activation | ||
Metabolism Endothelial NPR-C promotes insulin resistance via Caveolin-1-mediated insulin transcytosis. | ||
Redox Biol TrxR1 is involved in the activation of Caspase-11 by regulating the oxidative-reductive status of Trx-1 | ||
Adv Sci (Weinh) Caveolin-1 Stabilizes SERCA2 to Counteract Acute Kidney Injury via Suppression of Ca(2+)-Dependent Endoplasmic Reticulum Stress in Distal Tubules.
| ||
Cell Death Dis The methionine salvage pathway-involving ADI1 inhibits hepatoma growth by epigenetically altering genes expression via elevating S-adenosylmethionine. |
