Home
Products
Primary Antibodies
Caveolin-1 Monoclonal antibody (66067-1-Ig)

Featured Product
KD/KO Validated

Caveolin-1 Monoclonal antibody

Caveolin-1 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA

Cat No. 66067-1-Ig

Clone No.6C2B2

Publications(33)

Review Product

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig and More (4)

Applications

WB, IHC, IF/ICC, IF-P, IP, ELISA

Synonyms

CAV1, Caveolin 1, 6C2B2, BSCL3, CAV

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Unconjugated

CoraLite® Plus 488 CoraLite®594

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHC-AutostainerIHCIF-PIF/ICC

WB analysis using 66067-1-Ig
Various lysates were subjected to SDS PAGE followed by western blot with 66067-1-Ig (Caveolin-1 antibody) at dilution of 1:100000 incubated at room temperature for 1.5 hours.
WB analysis of HeLa using 66067-1-Ig
WB result of Caveolin-1 antibody (66067-1-Ig; 1:100000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Caveolin-1 transfected HeLa cells.
IHC staining of human ovary cancer using 66067-1-Ig
Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 66067-1-Ig (Caveolin-1 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer.
IHC staining of human breast cancer using 66067-1-Ig
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66067-1-Ig (Caveolin-1 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer.
IHC staining of human liver using 66067-1-Ig
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66067-1-Ig (Caveolin-1 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer.
IHC staining of human lung using 66067-1-Ig
Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 66067-1-Ig (Caveolin-1 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer.
IHC staining of human tonsillitis using 66067-1-Ig
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66067-1-Ig (Caveolin-1 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer.
IHC staining of human tonsillitis using 66067-1-Ig
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66067-1-Ig (Caveolin-1 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer.
IHC staining of human spleen using 66067-1-Ig
Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 66067-1-Ig (Caveolin-1 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer.
IHC staining of human appendicitis using 66067-1-Ig
Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 66067-1-Ig (Caveolin-1 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer.
IHC staining of human ovary tumor using 66067-1-Ig
Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 66067-1-Ig (Caveolin-1 antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human breast cancer using 66067-1-Ig
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66067-1-Ig (Caveolin-1 antibody) at dilution of 1:5000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human stomach cancer using 66067-1-Ig
Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 66067-1-Ig (Caveolin-1 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human appendicitis using 66067-1-Ig
Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 66067-1-Ig (Caveolin-1 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human spleen using 66067-1-Ig
Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 66067-1-Ig (Caveolin-1 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human tonsillitis using 66067-1-Ig
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66067-1-Ig (Caveolin-1 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human tonsillitis using 66067-1-Ig
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66067-1-Ig (Caveolin-1 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human lung using 66067-1-Ig
Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 66067-1-Ig (Caveolin-1 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human liver using 66067-1-Ig
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66067-1-Ig (Caveolin-1 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human breast cancer using 66067-1-Ig
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66067-1-Ig (Caveolin-1 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human stomach cancer using 66067-1-Ig
Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 66067-1-Ig (Caveolin-1 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human placenta using 66067-1-Ig
Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 66067-1-Ig (Caveolin-1 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human ovary cancer using 66067-1-Ig
Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 66067-1-Ig (Caveolin-1 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human breast cancer using 66067-1-Ig
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66067-1-Ig (Caveolin-1 antibody) at dilution of 1:5000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human liver cancer using 66067-1-Ig
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66067-1-Ig (Caveolin-1 antibody) at dilution of 1:5000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human liver cancer using 66067-1-Ig
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66067-1-Ig (Caveolin-1 antibody) at dilution of 1:5000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human liver cancer using 66067-1-Ig
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66067-1-Ig (Caveolin-1 antibody) at dilution of 1:5000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human liver cancer using 66067-1-Ig
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66067-1-Ig (Caveolin-1 antibody) at dilution of 1:5000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IF Staining of human liver cancer using 66067-1-Ig
Immunofluorescent analysis of (4% PFA) fixed human liver cancer tissue using Caveolin-1 antibody (66067-1-Ig, Clone: 6C2B2 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).
IF Staining of human liver cancer using 66067-1-Ig
Immunofluorescent analysis of (4% PFA) fixed human liver cancer tissue using Caveolin-1 antibody (66067-1-Ig, Clone: 6C2B2 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).
IF Staining of human skin cancer using 66067-1-Ig
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human skin cancer tissue using Caveolin-1 antibody (66067-1-Ig, Clone: 6C2B2 ) at dilution of 1:150 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IF Staining of human skin cancer using 66067-1-Ig
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human skin cancer tissue using Caveolin-1 antibody (66067-1-Ig, Clone: 6C2B2 ) at dilution of 1:150 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IF Staining of mouse kidney using 66067-1-Ig
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse kidney tissue using Caveolin-1 antibody (66067-1-Ig, Clone: 6C2B2 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IF Staining of A549 using 66067-1-Ig
Immunofluorescent analysis of (4% PFA) fixed A549 cells using Caveolin-1 antibody (66067-1-Ig, Clone: 6C2B2 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1).

Overview

Tested Applications
Product Information
Publications (33)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	A549 cells, HeLa cells, A431 cells, PC-3 cells, human heart tissue, pig heart tissue, Rat heart tissue, mouse heart tissue
Positive IHC detected in	human ovary tumor tissue, human breast cancer tissue, human liver cancer tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF-P detected in	human liver cancer tissue, mouse kidney tissue, human skin cancer tissue
Positive IF/ICC detected in	A549 cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:2000-1:50000
Immunohistochemistry (IHC)	IHC : 1:2000-1:8000
Immunofluorescence (IF)-P	IF-P : 1:200-1:800
Immunofluorescence (IF)/ICC	IF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66067-1-Ig targets Caveolin-1 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity	human, mouse, rat, pig
Cited Reactivity	human, mouse, rat, pig, canine, monkey, chicken, sheep
Host / Isotype	Mouse / IgG1
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag8049 Product name: Recombinant human Caveolin-1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 11-179 aa of BC006432 Sequence: GHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI Predict reactive species
Full Name	caveolin 1, caveolae protein, 22kDa
Calculated Molecular Weight	22 kDa
Observed Molecular Weight	20-25 kDa
GenBank Accession Number	BC006432
Gene Symbol	CAV1
Gene ID (NCBI)	857
RRID	AB_11043343
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein G purification
UNIPROT ID	Q03135
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Caveolin-1 (CAV1), a multifunctional protein, is the main constituent molecule of caveolae and represents a scaffolding molecule for several signaling molecules including epidermal growth factor receptor (PMID: 19641024). Several studies have implicated that a reduced expression of CAV1 was found in cancers including head and neck carcinoma (PMID: 19002186). However, other studies recognize CAV1 as a tumor promoter because CAV1 is overexpressed in various kinds of cancers, especially in oral cancer (PMID: 20558341). Recent study also show that CAV1 is involved in gastric Cancer (PMID: 25339030).

Protocols

Product Specific Protocols
IF protocol for Caveolin-1 antibody 66067-1-Ig	Download protocol
IHC protocol for Caveolin-1 antibody 66067-1-Ig	Download protocol
WB protocol for Caveolin-1 antibody 66067-1-Ig	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

Species	Application	Title
human	IF	Nat Commun Endothelial discoidin domain receptor 1 senses flow to modulate YAP activation Authors - Jiayu Liu View Article
human	IF	Cancer Res Inhibition of EGFR Overcomes Acquired Lenvatinib Resistance Driven by STAT3-ABCB1 Signaling in Hepatocellular Carcinoma Authors - Beiyuan Hu View Article
human	WB	Mol Metab CLSTN3 gene variant associates with obesity risk and contributes to dysfunction in white adipose tissue. Authors - Ningning Bai View Article
human	WB	Cells Blocking EREG/GPX4 Sensitizes Head and Neck Cancer to Cetuximab through Ferroptosis Induction Authors - Aude Jehl View Article
canine	WB,IP,IF	FASEB J Lipid raft interacting galectin 8 regulates primary ciliogenesis Authors - Jhan-Jhang Syu View Article
mouse	IF	Food Chem Toxicol α-Hemolysin suppresses osteogenesis by inducing lipid rafts accumulation in bone marrow stromal cells. Authors - Guanqiao Liu View Article