Tested Applications
| Positive IF-P detected in | human liver cancer tissue, human skin cancer tissue | 
| Positive FC (Intra) detected in | HeLa cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 | 
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| IF | See 1 publications below | 
Product Information
CL594-66067 targets Caveolin-1 in IF-P, FC (Intra) applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig | 
| Cited Reactivity | mouse | 
| Host / Isotype | Mouse / IgG1 | 
| Class | Monoclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag8049 Product name: Recombinant human Caveolin-1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 11-179 aa of BC006432 Sequence: GHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI Predict reactive species | 
                                    
| Full Name | caveolin 1, caveolae protein, 22kDa | 
| Calculated Molecular Weight | 22 kDa | 
| Observed Molecular Weight | 20-25 kDa | 
| GenBank Accession Number | BC006432 | 
| Gene Symbol | CAV1 | 
| Gene ID (NCBI) | 857 | 
| RRID | AB_2883501 | 
| Conjugate | CoraLite®594 Fluorescent Dye | 
| Excitation/Emission Maxima Wavelengths | 588 nm / 604 nm | 
| Form | Liquid | 
| Purification Method | Protein G purification | 
| UNIPROT ID | Q03135 | 
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. | 
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. | 
Background Information
Caveolin-1 (CAV1), a multifunctional protein, is the main constituent molecule of caveolae and represents a scaffolding molecule for several signaling molecules including epidermal growth factor receptor (PMID: 19641024). Several studies have implicated that a reduced expression of CAV1 was found in cancers including head and neck carcinoma (PMID: 19002186). However, other studies recognize CAV1 as a tumor promoter because CAV1 is overexpressed in various kinds of cancers, especially in oral cancer (PMID: 20558341). Recent study also show that CAV1 is involved in gastric cancer (PMID: 25339030).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CL594 Caveolin-1 antibody CL594-66067 | Download protocol | 
| IF protocol for CL594 Caveolin-1 antibody CL594-66067 | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 



















