CCDC33 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CCDC33 Polyclonal antibody (25822-1-AP)

• 

  WB analysis using 25822-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25822-1-AP (CCDC33 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse testis using 25822-1-AP

  IP result of anti-CCDC33 (IP:25822-1-AP, 4ug; Detection:25822-1-AP 1:600) with mouse testis tissue lysate 1800 ug.

CCDC33 Polyclonal Antibody for WB, IP, ELISA

Cat No. 25822-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, ELISA

Synonyms

Cancer/testis antigen 61, CT61

---

Tested Applications

• Positive WB detected in: rat testis tissue
• Positive IP detected in: mouse testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25822-1-AP targets CCDC33 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22893

  Product name: Recombinant human CCDC33 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-206 aa of BC025689

  Sequence: SEMNNYRRAMQKMAEDILSLRRQASILEGENRILRSRLAQQEEEEGQGKASEAQNTVSMKQKLLLSELDMKKLRDRVQHLQNELIRKNDREKELLLLYQAQQPQAALLKQYQGKLQKMKALEETVRHQEKVIEKMERVLEDRLQDRSKPPPLNRQQGKPYTGFPMLSASGLPLGSMGENLPVELYSVLLAENAKLRTELDKNRHQQ

• Full Name: coiled-coil domain containing 33
• Calculated Molecular Weight: 958 aa, 107 kDa
• Observed Molecular Weight: 85 kDa
• GenBank Accession Number: BC025689
• Gene Symbol: CCDC33
• Gene ID (NCBI): 80125
• RRID: AB_3742161
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N5R6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The human CCDC33 gene was reported to encode a cancer/testis (CT) antigen, which is located on 15q24.1, spans a region of 99.8 kb, and consists of 20 exons (PMID: 28639886). CCDC33 is predominantly expressed in the testis and undergoes alternative splicing to produce at least 5 different transcripts (37kda, 41kda, 85kda, 107kda, 114kda). Human CCDC33 was reported to be a cancer/testis (CT) protein. Abundant expression of Ccdc33 is evident during mouse spermatogenesis (PMID: 33942254).