Use Able AI chat for product recommendations

CCK Polyclonal antibody

CCK Polyclonal Antibody for IHC, ELISA

Cat No. 13074-2-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF, ELISA, Cell treatment

cholecystokinin

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inhuman pancreas tissue, human stomach tissue, mouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13074-2-AP targets CCK in IHC, IF, ELISA, Cell treatment applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3725

Product name: Recombinant human CCK protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-115 aa of BC008283

Sequence: MNSGVCLCVLMAVLAAGALTQPVPPADPAGSGLQRAEEAPRRQLRVSQRTDGESRAHLGALLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS

Predict reactive species
Full Name cholecystokinin
Calculated Molecular Weight 115 aa, 13 kDa
GenBank Accession NumberBC008283
Gene Symbol CCK
Gene ID (NCBI) 885
RRIDAB_2228728
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP06307
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cholecystokinin (CCK) is a classic gut hormone. CCK is also a complex system of peptides expressed in several molecular forms in enteroendocrine I cells, in cerebral and peripheral neurons, in cardiac myocytes and spermatozoa. The encoded preproprotein is proteolytically processed to generate multiple protein products, including the peptide hormones cholecystokinin-8, -12, -33, and others. The encoded peptides have been shown to regulate gastric acid secretion and food intake.

Protocols

Product Specific Protocols
IHC protocol for CCK antibody 13074-2-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle

Neuron

Molecular pathways and diagnosis in spatially resolved Alzheimer's hippocampal atlas

Authors - Pan Wang
Cell treatment

J Fungi (Basel)

Two Cladosporium Fungi with Opposite Functions to the Chinese White Wax Scale Insect Have Different Genome Characters.

Authors - Wei Liu

J Ethnopharmacol

Tibetan medicine Ru-yi-Zhen-bao Pills exhibits anti-migraine effect through mediating PAG anti-nociceptive channel.

Authors - Ya Min Luo

Chem Biodivers

Triterpenes From Lagerstroemia indica L. Bark With Anti-ZIKV Activity

Authors - Yuan-Lin Kong

Chem Biol Drug Des

An Integrative Methylation-Metabolism Gene Signature Defines Prognosis and Immunosuppressive Microenvironment in Prostate Cancer.

Authors - Chao Zhang
IF

Sci Total Environ

Micro/nanoplastics impair the feeding of goldfish by disrupting the complicated peripheral and central regulation of appetite

Authors - Weixia Zhang

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Sai Sindhura (Verified Customer) (08-19-2026)

very good antibody

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
Loading...
||
New chat

Able

正在加载,请稍候...