Tested Applications
Positive IHC detected in | human pancreas tissue, human stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
IF | See 1 publications below |
Product Information
13074-2-AP targets CCK in IHC, IF, ELISA, Cell treatment applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag3725 Product name: Recombinant human CCK protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-115 aa of BC008283 Sequence: MNSGVCLCVLMAVLAAGALTQPVPPADPAGSGLQRAEEAPRRQLRVSQRTDGESRAHLGALLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS Predict reactive species |
Full Name | cholecystokinin |
Calculated Molecular Weight | 115 aa, 13 kDa |
GenBank Accession Number | BC008283 |
Gene Symbol | CCK |
Gene ID (NCBI) | 885 |
RRID | AB_2228728 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P06307 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Cholecystokinin (CCK) is a classic gut hormone. CCK is also a complex system of peptides expressed in several molecular forms in enteroendocrine I cells, in cerebral and peripheral neurons, in cardiac myocytes and spermatozoa. The encoded preproprotein is proteolytically processed to generate multiple protein products, including the peptide hormones cholecystokinin-8, -12, -33, and others. The encoded peptides have been shown to regulate gastric acid secretion and food intake.
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for CCK antibody 13074-2-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Neuron Molecular pathways and diagnosis in spatially resolved Alzheimer's hippocampal atlas | ||
J Fungi (Basel) Two Cladosporium Fungi with Opposite Functions to the Chinese White Wax Scale Insect Have Different Genome Characters. | ||
J Ethnopharmacol Tibetan medicine Ru-yi-Zhen-bao Pills exhibits anti-migraine effect through mediating PAG anti-nociceptive channel. | ||
Sci Total Environ Micro/nanoplastics impair the feeding of goldfish by disrupting the complicated peripheral and central regulation of appetite |