Tested Applications
| Positive IHC detected in | human pancreas tissue, human stomach tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
13074-2-AP targets CCK in IHC, IF, ELISA, Cell treatment applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3725 Product name: Recombinant human CCK protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-115 aa of BC008283 Sequence: MNSGVCLCVLMAVLAAGALTQPVPPADPAGSGLQRAEEAPRRQLRVSQRTDGESRAHLGALLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS Predict reactive species |
| Full Name | cholecystokinin |
| Calculated Molecular Weight | 115 aa, 13 kDa |
| GenBank Accession Number | BC008283 |
| Gene Symbol | CCK |
| Gene ID (NCBI) | 885 |
| RRID | AB_2228728 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P06307 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Cholecystokinin (CCK) is a classic gut hormone. CCK is also a complex system of peptides expressed in several molecular forms in enteroendocrine I cells, in cerebral and peripheral neurons, in cardiac myocytes and spermatozoa. The encoded preproprotein is proteolytically processed to generate multiple protein products, including the peptide hormones cholecystokinin-8, -12, -33, and others. The encoded peptides have been shown to regulate gastric acid secretion and food intake.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for CCK antibody 13074-2-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CCK Polyclonal antibody (Cat# 13074-2-AP) has 8 citations spanning journals including Nature Communications, Neuron, Science of the Total Environment, Journal of Ethnopharmacology, J Fungi, Chem Biol Drug Des, Chem Biodivers, and Research Square. Research fields covered include neuroscience (pain, Alzheimer's disease, spatial transcriptomics), appetite and feeding regulation, migraine, fungal genomics, prostate cancer immunology, and antiviral studies. Applications cited include IF, IHC, and cell treatment.
| Species | Application | Title |
|---|---|---|
Nat Commun Paraventricular hypothalamic input to anterior cingulate cortex controls food preferences in chronic visceral pain mice. | ||
Neuron Molecular pathways and diagnosis in spatially resolved Alzheimer's hippocampal atlas | ||
Sci Total Environ Micro/nanoplastics impair the feeding of goldfish by disrupting the complicated peripheral and central regulation of appetite | ||
J Ethnopharmacol Tibetan medicine Ru-yi-Zhen-bao Pills exhibits anti-migraine effect through mediating PAG anti-nociceptive channel. | ||
J Fungi (Basel) Two Cladosporium Fungi with Opposite Functions to the Chinese White Wax Scale Insect Have Different Genome Characters. | ||
Chem Biol Drug Des An Integrative Methylation-Metabolism Gene Signature Defines Prognosis and Immunosuppressive Microenvironment in Prostate Cancer. |
Reviews
What customers say
The single review for this product is highly positive, with a 5-star rating. The user tested the antibody for Western Blot at a 1:2000 dilution and described it as a "very good antibody." Overall, the feedback indicates strong performance and satisfaction with the product's quality in WB applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Sai Sindhura (Verified Customer) (08-19-2026) | very good antibody
|
