Product Information
83278-1-PBS targets CCL17/TARC as part of a matched antibody pair:
MP00308-1: 83278-1-PBS capture and 83278-2-PBS detection (validated in Cytometric bead array)
Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Affinity | KD=7.69 x 10-11M KOff=1.38 x 10-4M KOn=1.80 x 106M |
| Immunogen |
CatNo: Eg0379 Product name: Recombinant Human CCL17/TARC protein (His Tag) Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 24-94 aa of BC112066 Sequence: ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS Predict reactive species |
| Full Name | chemokine (C-C motif) ligand 17 |
| Calculated Molecular Weight | 94 aa, 11 kDa |
| GenBank Accession Number | BC112066 |
| Gene Symbol | CCL17 |
| Gene ID (NCBI) | 6361 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q92583 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |

