CCL22/MDC Recombinant monoclonal antibody, PBS Only

• 

CCL22/MDC Uni-rAb^® Recombinant Antibody for Indirect ELISA

Cat No. 84370-2-PBS

Clone No.241668D6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Indirect ELISA

Synonyms

CCL22, MDC, C C motif chemokine 22, CC chemokine STCP-1, C-C motif chemokine 22

---

Product Information

84370-2-PBS targets CCL22/MDC in Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1974

  Product name: Recombinant Human CCL22 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-N-rFc

  Tag: N-rFc

  Domain: 25-93 aa of BC027952

  Sequence: GPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKEICADPRVPWVKMILNKLSQ

• Full Name: chemokine (C-C motif) ligand 22
• Calculated Molecular Weight: 93 aa, 11 kDa
• GenBank Accession Number: BC027952
• Gene Symbol: CCL22/MDC
• Gene ID (NCBI): 6367
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O00626
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.