Product Information
60443-4-PBS targets CCL24/Eotaxin 2 as part of a matched antibody pair:
MP50599-3: 60443-3-PBS capture and 60443-4-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Eg0395 Product name: Recombinant Human CCL24 protein (His Tag) Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 27-119 aa of NM_002991 Sequence: VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC Predict reactive species |
| Full Name | chemokine (C-C motif) ligand 24 |
| Calculated Molecular Weight | 13kd |
| GenBank Accession Number | NM_002991 |
| Gene Symbol | CCL24/Eotaxin 2 |
| Gene ID (NCBI) | 6369 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G Magarose purification |
| UNIPROT ID | O00175 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |

