CCNJ Polyclonal antibody, PBS Only

• 

  WB analysis using 15694-1-AP (same clone as 15694-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15694-1-AP (CCNJ antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15694-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat kidney using 15694-1-AP (same clone as 15694-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 15694-1-AP (CCNJ antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15694-1-PBS in a different storage buffer formulation.

CCNJ Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 15694-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

15694-1-PBS targets CCNJ in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8273

  Product name: Recombinant human CCNJ protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-372 aa of BC043175

  Sequence: MELEGQWWRGQLAADIHQALRYKELKLPSYKGQSPQLSLRRYFADLIAIVSNRFTLCPSARHLAVYLLDLFMDRYDISIQQLHLVALSCLLLASKFEEKEDSVPKLEQLNSLGCMTNMNLVLTKQNLLHMELLLLETFQWNLCLPTAAHFIEYYLSEAVHETDLHDGWPMICLEKTKLYMAKYADYFLEVSLQVAAACVASSRIILRLSPTWPTRLHRLTAYSWDFLVQCIERLLIAHDNDVKEANKQRGQAGPQSAQLSVFQTASQPSRPVHFQQPQYLHQTHQTSLQYRHPTSEQPSCQQIVSTTHTSSYTLQTCPAGFQTSVQGLGHMQTGVGMSLAIPVEVKPCLSVSYNRSYQINEHYPCITPCFER

• Full Name: cyclin J
• Calculated Molecular Weight: 43 kDa
• Observed Molecular Weight: 43 kDa
• GenBank Accession Number: BC043175
• Gene Symbol: CCNJ
• Gene ID (NCBI): 54619
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5T5M9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CCNJ (Cyclin-J) Belongs to the Cyclin family. Cyclin J is expressed in early Drosophila embryos, and it is essential for mediating intestinal epithelial cell recovery from bacterial pore-forming toxin attack in both Drosophila and mice. Upon TLR and IFN stimulation, cyclin J restrained macrophage inflammatory responses irrespective of the cell cycle control. Cyclin J interacted with CDKs and facilitated the phosphorylation of a set of CDK substrates, including FoxK1 and Drp1. Phosphorylation inhibited FoxK1-mediated expression of glycolytic genes by reducing FoxK1 nuclear localization. Cyclin J-CDK-dependent Drp1 phosphorylation also resulted in mitochondrial fission and the suppression of ROS production (PMID: 35412849).