Product Information
66582-4-PBS targets CD100 as part of a matched antibody pair:
MP50276-2: 66582-4-PBS capture and 66582-2-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
Tested Reactivity | human |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag26461 Product name: Recombinant human CD100 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 756-862 aa of BC054500 Sequence: YKGYLPRQCLKFRSALLIGKKKPKSDFCDREQSLKETLVEPGSFSQQNGEHPKPALDTGYETEQDTITSKVPTDREDSQRIDDLSARDKPFDVKCELKFADSDADGD Predict reactive species |
Full Name | sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4D |
Calculated Molecular Weight | 96 kDa |
GenBank Accession Number | BC054500 |
Gene Symbol | SEMA4D/CD100 |
Gene ID (NCBI) | 10507 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | Q92854 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |