CD134/OX40 Polyclonal antibody

• 

  WB analysis using 29361-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29361-1-AP (CD134/OX40 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

CD134/OX40 Polyclonal Antibody for WB, ELISA

Cat No. 29361-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

WB, ELISA

Synonyms

ACT35, ACT35 antigen, CD134, CD134/OX40, OX40, OX40L receptor, TNFRSF4, TXGP1L

---

Tested Applications

• Positive WB detected in: MJ cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29361-1-AP targets CD134/OX40 in WB, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28521

  Product name: Recombinant human TNFRSF4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 29-214 aa of NM_003327

  Sequence: MLHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRA

• Full Name: tumor necrosis factor receptor superfamily, member 4
• Calculated Molecular Weight: 29 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: NM_003327
• Gene Symbol: CD134
• Gene ID (NCBI): 7293
• RRID: AB_3669684
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P43489
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD134, also known as OX40 and TNFRSF4, is a member of the TNFR-superfamily of receptors (PMID: 2828930; 9766631). It is a type I transmembrane protein predominantly expressed on activated T cells which include CD4 and CD8 T cells, Th2, Th1, and Th17 cells, as well as regulatory T cells (Tregs) (PMID: 20307208). CD134 is activated by its cognate ligand CD134L (OX40L) and functions as a T cell co-stimulatory molecule (PMID: 26215166). CD134-CD134L interactions have been proposed as a potential therapeutic target for treating autoimmune diseases, cancer and infectious disease (PMID: 26215166; 19426222).