CD163 Polyclonal antibody

• 

  WB analysis using 16646-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16646-1-AP (CD163 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of human placenta using 16646-1-AP

  IP result of anti-CD163 (IP:16646-1-AP, 4ug; Detection:16646-1-AP 1:2000 and HRP-conjugated Mouse Anti-Heavy Chain of Rabbit lgG SA00001-7H) with human placenta tissue lysate 1160 ug.

• 

  IHC staining of human placenta using 16646-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 16646-1-AP (CD163 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human placenta using 16646-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 16646-1-AP (CD163 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 16646-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 16646-1-AP (CD163 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 16646-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 16646-1-AP (CD163 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 16646-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 16646-1-AP (CD163 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 16646-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 16646-1-AP (CD163 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung using 16646-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 16646-1-AP (CD163 antibody) at dilution of 1:6000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung using 16646-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 16646-1-AP (CD163 antibody) at dilution of 1:6000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human tonsillitis using 16646-1-AP

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using CD163 antibody (16646-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of human tonsillitis using 16646-1-AP

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using CD163 antibody (16646-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of human liver using 16646-1-AP

  Immunofluorescent analysis of (4% PFA) fixed human liver tissue using CD163 antibody (16646-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of human liver using 16646-1-AP

  Immunofluorescent analysis of (4% PFA) fixed human liver tissue using CD163 antibody (16646-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of human placenta using 16646-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human placenta tissue using CD163 antibody (16646-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

CD163 Polyclonal Antibody for WB, IHC, IF-P, IP, ELISA

Cat No. 16646-1-AP

Publications(231)

Reviews (5)

Host / Isotype

Rabbit / IgG

Reactivity

human, pig and More (2)

Applications

WB, IHC, IF-P, IP, ELISA

Synonyms

CD163 molecule, Hemoglobin scavenger receptor, M130, MM130, Scavenger receptor cysteine-rich type 1 protein M130

---

Tested Applications

• Positive WB detected in: human placenta tissue, pig spleen tissue
• Positive IP detected in: human placenta tissue
• Positive IHC detected in: human placenta tissue, human liver tissue, human lung tissue, human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human tonsillitis tissue, human liver tissue, human placenta tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 47 publications below
• IHC: See 90 publications below
• IF: See 115 publications below

Product Information

16646-1-AP targets CD163 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, pig samples.

• Tested Reactivity: human, pig
• Cited Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10029

  Product name: Recombinant human CD163 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 46-401 aa of BC051281

  Sequence: GTDKELRLVDGENKCSGRVEVKVQEEWGTVCNNGWSMEAVSVICNQLGCPTAIKAPGWANSSAGSGRIWMDHVSCRGNESALWDCKHDGWGKHSNCTHQQDAGVTCSDGSNLEMRLTRGGNMCSGRIEIKFQGRWGTVCDDNFNIDHASVICRQLECGSAVSFSGSSNFGEGSGPIWFDDLICNGNESALWNCKHQGWGKHNCDHAEDAGVICSKGADLSLRLVDGVTECSGRLEVRFQGEWGTICDDGWDSYDAAVACKQLGCPTAVTAIGRVNASKGFGHIWLDSVSCQGHEPAVWQCKHHEWGKHYCNHNEDAGVTCSDGSDLELRLRGGGSRCAGTVEVEIQRLLGKVCDRG

• Full Name: CD163 molecule
• Calculated Molecular Weight: 1156 aa, 125 kDa
• Observed Molecular Weight: 130-150 kDa
• GenBank Accession Number: BC051281
• Gene Symbol: CD163
• Gene ID (NCBI): 9332
• ENSEMBL Gene ID: ENSG00000177575
• RRID: AB_2756528
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86VB7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD163 is a transmembrane protein which belongs to the scavenger receptor cysteine-rich (SRCR) superfamily. This protein is a scavenger receptor for the hemoglobin-haptoglobin complex and is a marker for monocytes and macrophages. Soluble CD163 (sCD163), as a result of ectodomain shedding during inflammatory activation of macrophages, circulates in blood and has been suggested as a plasma/serum marker for macrophage activity.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Mil Med Res; Caveolin-1 is critical for hepatic iron storage capacity in the development of nonalcoholic fatty liver disease; Authors - Guang-Hui Deng
mouse,human	IF	Nat Aging; Single-cell and spatial RNA sequencing identify divergent microenvironments and progression signatures in early- versus late-onset prostate cancer; Authors - Yifei Cheng
human	IF	J Clin Invest; CAP2 promotes gastric cancer metastasis by mediating the interaction between tumor cells and tumor-associated macrophages; Authors - Guohao Zhang
mouse	WB	Adv Sci (Weinh); Inflammatory Fibroblast-Like Synoviocyte-Derived Exosomes Aggravate Osteoarthritis via Enhancing Macrophage Glycolysis; Authors - Bin Liu
human	IHC	Cell Rep Med; Targeting neoadjuvant chemotherapy-induced metabolic reprogramming in pancreatic cancer promotes anti-tumor immunity and chemo-response; Authors - Rong Tang
human	IF	Nat Commun; Single-cell analysis of human glioma and immune cells identifies S100A4 as an immunotherapy target.; Authors - Nourhan Abdelfattah

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Brittney (Verified Customer) (10-09-2025)

Antibody nicely stained M2 macrophage cells.

• Applications: Immunohistochemistry, Immunofluorescence
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Tumor

FH

Jaouhara (Verified Customer) (12-05-2023)

Works very well in immunohistochemistry (human cartilage)

• Applications: Immunohistochemistry
• Cell Tissue Type: Cartilage

FH

Kenzo (Verified Customer) (08-29-2023)

Works well by IF on frozen mouse liver tissue sections.

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1:500
• Cell Tissue Type: Liver

FH

Yasuyo (Verified Customer) (05-27-2022)

Works pretty good.

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1:250
• Cell Tissue Type: Gastric Cancer

CD163 Antibody Immunofluorescence validation (1:250 dilution) in Gastric Cancer (Cat no:16646-1-AP)

FH

Emma (Verified Customer) (11-29-2021)

Works well by IF on FFPE tissue @ 1:100 with a Tris-EDTA antigen retrieval.

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1:100
• Cell Tissue Type: Prostate

CD163 Antibody Immunofluorescence validation (1:100 dilution) in Prostate (Cat no:16646-1-AP)