Home
Products
Primary Antibodies
Flow Cytometry Antibodies
Anti-Human CD164 Rabbit Recombinant Antibody, PBS Only (98239-1-PBS)

Anti-Human CD164 Rabbit Recombinant Antibody, PBS Only

Name: Anti-Human CD164 Rabbit Recombinant Antibody, PBS Only, 1mg
Brand: Proteintech
SKU: 98239-1-PBS-1MG

CD164 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98239-1-PBS

Clone No. 241950F3

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Synonyms

241950F3, MGC-24, MGC-24v, MUC-24, Multi-glycosylated core protein 24

Formulation: PBS Only

PBS, Azide

PBS Only

Conjugate: Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllFC

FC experiment of human PBMCs using 98239-1-RR (same clone as 98239-1-PBS)
1x10^6 human PBMCs were surface stained with 0.25 ug Anti-Human CD164 Rabbit Recombinant Antibody (98239-1-RR, Clone: 241950F3) or Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were then stained with and 0.25 ug CoraLite® Plus 647 Anti-Human CD14. Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed. This data was developed using the same antibody clone with 98239-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
×
1x10^6 human PBMCs were surface stained with 0.25 ug Anti-Human CD164 Rabbit Recombinant Antibody (98239-1-RR, Clone: 241950F3) or Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were then stained with and 0.25 ug CoraLite® Plus 647 Anti-Human CD14. Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed. This data was developed using the same antibody clone with 98239-1-PBS in a different storage buffer formulation.
FC experiment of human PBMCs using 98239-1-RR (same clone as 98239-1-PBS)
1x10^6 human PBMCs were surface stained with 0.25 ug Anti-Human CD164 Rabbit Recombinant Antibody (98239-1-RR, Clone:241950F3) (red), or Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed. This data was developed using the same antibody clone with 98239-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
×
1x10^6 human PBMCs were surface stained with 0.25 ug Anti-Human CD164 Rabbit Recombinant Antibody (98239-1-RR, Clone:241950F3) (red), or Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed. This data was developed using the same antibody clone with 98239-1-PBS in a different storage buffer formulation.

Able AI

What's the best dilution for CD164 in ?

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

98239-1-PBS targets CD164 in FC applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Eg1690 Product name: Recombinant Human CD164 protein (rFc Tag) (HPLC verified) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 24-162 aa of NM_006016.6 Sequence: DKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFD Predict reactive species
Full Name	CD164 molecule, sialomucin
Calculated Molecular Weight	21kDa
GenBank Accession Number	NM_006016.6
Gene Symbol	CD164
Gene ID (NCBI)	8763
RRID	AB_3745906
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	Q04900-1
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Sialomucins are a heterogeneous group of secreted or membrane-associated mucins that appear to play 2 key but opposing roles in vivo: first as cytoprotective or antiadhesive agents, and second as adhesion receptors. CD164 is a type I integral transmembrane sialomucin that functions as an adhesion receptor (PMID: 9680353)(PMID: 17077324). Sialomucin CD164 (MUC-24), also referred to multi-glycosylated core protein 24 (MGC24), is known to function as a receptor that regulates stem cell localization to the bone marrow. CD164 may play a key role in hematopoiesis by facilitating the adhesion of CD34+ cells to the stroma and by negatively regulating CD34+CD38(lo/-) cell proliferation. Important role of CD164 in in prostate cancer metastasis, promoting myogenesis and regulating myoblast migration so far have been revealed (PMID: 9763543)(PMID: 16859559)(PMID: 17077324).