Anti-Mouse CD164 Rabbit Recombinant Antibody, PBS Only

• 

  FC experiment of Transfected HEK-293T using 98419-3-RR (same clone as 98419-3-PBS)

  1x10^6 HEK-293T cells or CD164 transfected HEK-293T cells were surface stained with 0.25 ug Anti-Mouse CD164 Rabbit RecAb (98419-3-RR, Clone:242986C2) and Multi-rAb CoraLite ® Plus 647-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR005). Cells were not fixed. This data was developed using the same antibody clone with 98419-3-PBS in a different storage buffer formulation.

• 

  FC experiment of Transfected HEK-293T using 98419-3-RR (same clone as 98419-3-PBS)

  1x10^6 HEK-293T cells or CD164-transfected HEK-293T cells were surface stained with 0.25 ug Anti-Mouse CD164 Rabbit RecAb (98419-3-RR, Clone: 242986C2) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and Multi-rAb CoraLite ® Plus 647-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR005). Cells were not fixed. This data was developed using the same antibody clone with 98419-3-PBS in a different storage buffer formulation.

CD164 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98419-3-PBS

Clone No.242986C2

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

Endolyn, MGC-24, MGC-24v, MUC-24, Multi-glycosylated core protein 24

---

Product Information

98419-3-PBS targets CD164 in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2645

  Product name: Recombinant Mouse CD164 protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 24-162 aa of NM_016898.2

  Sequence: QPNITTLAPNVTEVPTTTTKVVPTTQMPTVLPETCASFNSCVSCVNATFTNNITCFWLHCQEANKTYCANEPLSNCSQVNRTDLCSVIPPTTPVPTNSTAKPTTRPSSPTPTPSVVTSAGTTNTTLTPTSQPERKSTFD

• Full Name: CD164 antigen
• Calculated Molecular Weight: 21 kDa
• GenBank Accession Number: NM_016898.2
• Gene Symbol: Cd164
• Gene ID (NCBI): 53599
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9R0L9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.