CD19 Polyclonal antibody

• 

  IHC staining of mouse spleen using 31263-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 31263-1-AP (CD19 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse spleen using 31263-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 31263-1-AP (CD19 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat spleen using 31263-1-AP

  Immunohistochemical analysis of paraffin-embedded rat spleen tissue slide using 31263-1-AP (CD19 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat spleen using 31263-1-AP

  Immunohistochemical analysis of paraffin-embedded rat spleen tissue slide using 31263-1-AP (CD19 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CD19 Polyclonal Antibody for IHC, ELISA

Cat No. 31263-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

IHC, ELISA

Synonyms

B-lymphocyte antigen CD19, CD19 antigen

---

Tested Applications

• Positive IHC detected in: mouse spleen tissue, rat spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31263-1-AP targets CD19 in IHC, ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg0907

  Product name: Recombinant Mouse CD19 protein (His Tag)

  Source: mammalian cells-derived, pCMV (S18)

  Tag: C-6*HIS

  Domain: 19-287 aa of NM_009844.2

  Sequence: RPQKSLLVEVEEGGNVVLPCLPDSSPVSSEKLAWYRGNQSTPFLELSPGSPGLGLHVGSLGILLVIVNVSDHMGGFYLCQKRPPFKDIWQPAWTVNVEDSGEMFRWNASDVRDLDCDLRNRSSGSHRSTSGSQLYVWAKDHPKVWGTKPVCAPRGSSLNQSLINQDLTVAPGSTLWLSCGVPPVPVAKGSISWTHVHPRRPNVSLLSLSLGGEHPVREMWVWGSLLLLPQATALDEGTYYCLRGNLTIERHVKVIARSAVWLWLLRTGG

• Full Name: CD19 antigen
• Calculated Molecular Weight: 60 kDa
• GenBank Accession Number: NM_009844.2
• Gene Symbol: Cd19
• Gene ID (NCBI): 12478
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P25918
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD19 is a 95 kDa type I transmembrane glycoprotein belonging to the immunoglobulin superfamily (PMID: 2472450). It is expressed by B cells and follicular dendritic cells. CD19 is up-regulated at the step of B-lineage commitment during the differentiation of the hematopoietic stem cell, it remains on during subsequent stages of differentiation until finally down-regulated during terminal differentiation into plasma cells (PMID: 8528044). CD19 is involved in B cell development, activation and differentiation. It is the dominant component for the signaling complex on B cells that includes CD21 (CR2), CD81 (TAPA-1) and CD225 and acts as a critical co-receptor for BCR signal transduction (PMID: 23210908).