Product Information
84368-5-PBS targets CD28 in Indirect ELISA applications and shows reactivity with mouse samples.
| Tested Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg1408 Product name: Recombinant Mouse CD28 protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 20-150 aa of NM_007642.4 Sequence: NKILVKQSPLLVVDSNEVSLSCRYSYNLLAKEFRASLYKGVNSDVEVCVGNGNFTYQPQFRSNAEFNCDGDFDNETVTFRLWNLHVNHTDIYFCKIEFMYPPPYLDNERSNGTIIHIKEKHLCHTQSSPKL Predict reactive species |
| Full Name | CD28 antigen |
| Calculated Molecular Weight | 25 kDa |
| GenBank Accession Number | NM_007642.4 |
| Gene Symbol | Cd28 |
| Gene ID (NCBI) | 12487 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P31041 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
