Product Information
CL488-67242 targets CD300A in applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5776 Product name: Recombinant human CD300A protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 21-141 aa of BC032352 Sequence: CRTVAGPVGGSLSVQCPYEKEHRTLNKYWCRPPQIFLCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPVVEVEVSVFPASTSMTPASITAAKT Predict reactive species |
| Full Name | CD300a molecule |
| Calculated Molecular Weight | 299 aa, 33 kDa |
| Observed Molecular Weight | 50-60 kDa |
| GenBank Accession Number | BC032352 |
| Gene Symbol | CD300a |
| Gene ID (NCBI) | 11314 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Excitation Laser | Blue laser (488 nm) |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q9UGN4 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
