CD300LD Polyclonal antibody

• 

  WB analysis of MCF-7 using 30798-1-AP

  WB result of CD300LD antibody (30798-1-AP; 1:800; incubated at room temperature for 1.5 hours) with sh-Control and sh-CD300LD transfected MCF-7 cells.

• 

  WB analysis using 30798-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30798-1-AP (CD300LD antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

CD300LD Polyclonal Antibody for WB, ELISA

Cat No. 30798-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

CMRF35A4, CMRF35 like molecule 4, CMRF35 A4, CLM 4, CD300D

---

Tested Applications

• Positive WB detected in: A549 cells, MCF-7 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30798-1-AP targets CD300LD in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29307

  Product name: Recombinant human CD300LD protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 122-194 aa of NM_001115152

  Sequence: VTINPGTQTAVSEWTTTTASLAFTAAATQKTSSPLTRSPLKSTHFLFLFLLELPLLLSMLGTVLWVNRPQRRS

• Full Name: CD300 molecule-like family member d
• Calculated Molecular Weight: 22 kDa
• Observed Molecular Weight: 40-43 kDa
• GenBank Accession Number: NM_001115152
• Gene Symbol: CD300LD
• Gene ID (NCBI): 100131439
• RRID: AB_3669758
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6UXZ3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD300LD, also known as CD300D and CMRF35A4, is a member of the CD300 family. The CD300 family of molecules modulates a broad and diverse range of immune cell processes via their paired activating and inhibitory receptor functions. CD300LD is a 194 amino acid single-pass type I membrane protein containing an Ig-like V-type (immunoglobulin-like) domain. The apparent molecular weight is greater than the calculated molecular weight of 22 kDa, probably due to post-translational modification, presumably by glycosylation.