Tested Applications
Positive WB detected in | human peripheral blood platelets, Jurkat cells, THP-1 cells |
Positive IHC detected in | human liver cancer tissue, human breast cancer tissue, human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF-P detected in | human placenta tissue, human liver cancer tissue |
Positive IF/ICC detected in | HUVEC cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:5000-1:50000 |
Immunohistochemistry (IHC) | IHC : 1:5000-1:20000 |
Immunofluorescence (IF)-P | IF-P : 1:400-1:1600 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:1000-1:4000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 15 publications below |
IHC | See 14 publications below |
IF | See 64 publications below |
FC | See 1 publications below |
Product Information
66065-2-Ig targets CD31 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human, rabbit |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag19730 Product name: Recombinant human CD31 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 428-738 aa of BC022512 Sequence: EVRCESISGTLPISYQLLKTSKVLENSTKNSNDPAVFKDNPTEDVEYQCVADNCHSHAKMLSEVLRVKVIAPVDEVQISILSSKVVESGEDIVLQCAVNEGSGPITYKFYREKEGKPFYQMTSNATQAFWTKQKANKEQEGEYYCTAFNRANHASSVPRSKILTVRVILAPWKKGLIAVVIIGVIIALLIIAAKCYFLRKAKAKQMPVEMSRPAVPLLNSNNEKMSDPNMEANSHYGHNDDVGNHAMKPINDNKEPLNSDVQYTEVQVSSAESHKDLGKKDTETVYSEVRKAVPDAVESRYSRTEGSLDGT Predict reactive species |
Full Name | platelet/endothelial cell adhesion molecule |
Calculated Molecular Weight | 83 kDa |
Observed Molecular Weight | 120-130 kDa |
GenBank Accession Number | BC022512 |
Gene Symbol | CD31 |
Gene ID (NCBI) | 5175 |
ENSEMBL Gene ID | ENSG00000261371 |
RRID | AB_2918476 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | P16284 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Platelet endothelial cell adhesion molecule-1 (PECAM-1, CD31) is a member of the immunoglobulin gene superfamily of cell adhesion molecules. CD31 is a transmembrane glycoprotein that is highly expressed on the surface of the endothelium, making up a large portion of its intracellular junctions. PECAM-1 is also present on the surface of hematopoietic cells and immune cells including platelets, monocytes, neutrophils, natural killer cells, megakaryocytes and some types of T-cell (PMID: 9011572). As well as its role in cell-cell adhesion, PECAM-1 functions as a signaling receptor, and is involved in important physiological events such as nitric oxide production, regulation of T-cell immunity and tolerance, leukocyte transendothelial migration and inflammation and angiogenesis (PMID: 21183735; 20978210; 17872453; 20634489).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for CD31 antibody 66065-2-Ig | Download protocol |
IHC protocol for CD31 antibody 66065-2-Ig | Download protocol |
IF protocol for CD31 antibody 66065-2-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
ACS Nano Collagen-Targeting Self-Assembled Nanoprobes for Multimodal Molecular Imaging and Quantification of Myocardial Fibrosis in a Rat Model of Myocardial Infarction | ||
J Exp Clin Cancer Res CD151-enriched migrasomes mediate hepatocellular carcinoma invasion by conditioning cancer cells and promoting angiogenesis | ||
Cardiovasc Diabetol Deficiency of neutral cholesterol ester hydrolase 1 (NCEH1) impairs endothelial function in diet-induced diabetic mice | ||
J Neuroinflammation Succinate-induced macrophage polarization and RBP4 secretion promote vascular sprouting in ocular neovascularization | ||
JCI Insight Uric acid formation is driven by crosstalk between skeletal muscle and other cell types | ||
Phytomedicine Withaferin A protects against epilepsy by promoting LCN2-mediated astrocyte polarization to stopping neuronal ferroptosis |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Alessandro (Verified Customer) (12-09-2023) | good IF antibody. no unspecific staining
|