CD31 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• CD31 Monoclonal antibody (66065-2-Ig)

CD31 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA

Cat No. 66065-2-Ig

Clone No.3F8E2

Publications(135)

Reviews (2)

Host / Isotype

Mouse / IgG1

Reactivity

human and More (2)

Applications

WB, IHC, IF/ICC, IF-P, ELISA

Synonyms

3F8E2, EndoCAM, GPIIA, GPIIA', PECA1

• 

  WB analysis using 66065-2-Ig

  Untreated and PNGase F-treated lysates of human peripheral blood platelets were subjected to SDS PAGE followed by western blot with 66065-2-Ig (CD31 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. PNGase F was obtained from Atagenix (cat.NO. ata808).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human peripheral blood platelets using 66065-2-Ig

  human peripheral blood platelets were subjected to SDS PAGE followed by western blot with 66065-2-Ig (CD31 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 66065-2-Ig

  Untreated and PNGase F-treated lysates of Jurkat cells were subjected to SDS PAGE followed by western blot with 66065-2-Ig (CD31 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 66065-2-Ig

  Jurkat cells were subjected to SDS PAGE followed by western blot with 66065-2-Ig (CD31 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of THP-1 using 66065-2-Ig

  THP-1 cells were subjected to SDS PAGE followed by western blot with 66065-2-Ig (CD31 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human appendicitis using 66065-2-Ig

  Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 66065-2-Ig (CD31 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas using 66065-2-Ig

  Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 66065-2-Ig (CD31 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 66065-2-Ig

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66065-2-Ig (CD31 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 66065-2-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66065-2-Ig (CD31 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 66065-2-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66065-2-Ig (CD31 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas cancer using 66065-2-Ig

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 66065-2-Ig (CD31 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 66065-2-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66065-2-Ig (CD31 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 66065-2-Ig

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 66065-2-Ig (CD31 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human oesophagus cancer using 66065-2-Ig

  Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 66065-2-Ig (CD31 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 66065-2-Ig

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 66065-2-Ig (CD31 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 66065-2-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66065-2-Ig (CD31 antibody) at dilution of 1:10000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 66065-2-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66065-2-Ig (CD31 antibody) at dilution of 1:10000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 66065-2-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66065-2-Ig (CD31 antibody) at dilution of 1:10000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 66065-2-Ig

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66065-2-Ig (CD31 antibody) at dilution of 1:10000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 66065-2-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66065-2-Ig (CD31 antibody) at dilution of 1:10000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 66065-2-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66065-2-Ig (CD31 antibody) at dilution of 1:10000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human appendicitis using 66065-2-Ig

  Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 66065-2-Ig (CD31 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 66065-2-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66065-2-Ig (CD31 antibody) at dilution of 1:10000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 66065-2-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66065-2-Ig (CD31 antibody) at dilution of 1:10000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 66065-2-Ig

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 66065-2-Ig (CD31 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human oesophagus cancer using 66065-2-Ig

  Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 66065-2-Ig (CD31 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 66065-2-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66065-2-Ig (CD31 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas cancer using 66065-2-Ig

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 66065-2-Ig (CD31 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 66065-2-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66065-2-Ig (CD31 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 66065-2-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66065-2-Ig (CD31 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 66065-2-Ig

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66065-2-Ig (CD31 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas using 66065-2-Ig

  Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 66065-2-Ig (CD31 antibody) at dilution of 1:5000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 66065-2-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66065-2-Ig (CD31 antibody) at dilution of 1:5000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 66065-2-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66065-2-Ig (CD31 antibody) at dilution of 1:5000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 66065-2-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66065-2-Ig (CD31 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 66065-2-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66065-2-Ig (CD31 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human liver cancer using 66065-2-Ig

  Immunofluorescent analysis of (4% PFA) fixed human liver cancer tissue using CD31 antibody (66065-2-Ig, Clone: 3F8E2 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human liver cancer using 66065-2-Ig

  Immunofluorescent analysis of (4% PFA) fixed human liver cancer tissue using CD31 antibody (66065-2-Ig, Clone: 3F8E2 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human placenta using 66065-2-Ig

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human placenta tissue using CD31 antibody (66065-2-Ig, Clone: 3F8E2 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human placenta using 66065-2-Ig

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human placenta tissue using CD31 antibody (66065-2-Ig, Clone: 3F8E2 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HUVEC using 66065-2-Ig

  Immunofluorescent analysis of (4% PFA) fixed HUVEC cells using CD31 antibody (66065-2-Ig, Clone: 3F8E2 ) at dilution of 1:1000 and Multi-rAb CoraLite® Plus 594-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (Cat.NO. RGAM004 ).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HUVEC using 66065-2-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed HUVEC cells using CD31 antibody (66065-2-Ig, Clone: 3F8E2 ) at dilution of 1:2000 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002), Beta Tubulin antibody (80713-1-RR, Clone: 2O13, red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: human peripheral blood platelets, Jurkat cells, THP-1 cells
• Positive IHC detected in: human liver cancer tissue, human breast cancer tissue, human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human placenta tissue, human liver cancer tissue
• Positive IF/ICC detected in: HUVEC cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:5000-1:20000
• Immunofluorescence (IF)-P: IF-P : 1:400-1:1600
• Immunofluorescence (IF)/ICC: IF/ICC : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66065-2-Ig targets CD31 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, pig, rabbit
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19730

  Product name: Recombinant human CD31 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 428-738 aa of BC022512

  Sequence: EVRCESISGTLPISYQLLKTSKVLENSTKNSNDPAVFKDNPTEDVEYQCVADNCHSHAKMLSEVLRVKVIAPVDEVQISILSSKVVESGEDIVLQCAVNEGSGPITYKFYREKEGKPFYQMTSNATQAFWTKQKANKEQEGEYYCTAFNRANHASSVPRSKILTVRVILAPWKKGLIAVVIIGVIIALLIIAAKCYFLRKAKAKQMPVEMSRPAVPLLNSNNEKMSDPNMEANSHYGHNDDVGNHAMKPINDNKEPLNSDVQYTEVQVSSAESHKDLGKKDTETVYSEVRKAVPDAVESRYSRTEGSLDGT

• Full Name: platelet/endothelial cell adhesion molecule
• Calculated Molecular Weight: 83 kDa
• Observed Molecular Weight: 120-130 kDa
• GenBank Accession Number: BC022512
• Gene Symbol: CD31
• Gene ID (NCBI): 5175
• ENSEMBL Gene ID: ENSG00000261371
• RRID: AB_2918476
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P16284
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Platelet endothelial cell adhesion molecule-1 (PECAM-1, CD31) is a member of the immunoglobulin gene superfamily of cell adhesion molecules. CD31 is a transmembrane glycoprotein that is highly expressed on the surface of the endothelium, making up a large portion of its intracellular junctions. PECAM-1 is also present on the surface of hematopoietic cells and immune cells including platelets, monocytes, neutrophils, natural killer cells, megakaryocytes and some types of T-cell (PMID: 9011572). As well as its role in cell-cell adhesion, PECAM-1 functions as a signaling receptor, and is involved in important physiological events such as nitric oxide production, regulation of T-cell immunity and tolerance, leukocyte transendothelial migration and inflammation and angiogenesis (PMID: 21183735; 20978210; 17872453; 20634489).

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Cancer Cell; Conserved spatial subtypes and cellular neighborhoods of cancer-associated fibroblasts revealed by single-cell spatial multi-omics; Authors - Yunhe Liu
human	WB	Cell; ACSL4 and polyunsaturated lipids support metastatic extravasation and colonization; Authors - Yuqi Wang
human	IF	Nat Nanotechnol; Prevention of acute thrombosis with vascular endothelium antioxidative nanoscavenger.; Authors - Yixin Zhong
	IF	Cancer Commun (Lond); Targeting SPHK1 in macrophages remodels the tumor microenvironment and enhances anti-PD-1 immunotherapy efficacy in colorectal cancer liver metastasis.; Authors - Yizhi Zhan
	IF	Bioact Mater; Throw out an oligopeptide to catch a protein: Deep learning and natural language processing-screened tripeptide PSP promotes Osteolectin-mediated vascularized bone regeneration; Authors - Yu Chen
human	IF	Nat Commun; DSS1 inhibits autophagy to activate epithelial-mesenchymal transition in a pro-metastatic niche of renal cell carcinoma.; Authors - Xiaoyu Chen

Reviews

5.0 out of 5

2 verified customer reviews

What customers say

Automatically generated from the verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Refik (Verified Customer) (12-07-2025)

Works well with overnight incubation of human iPSC-derived vascular specific organoids using concentration 1:500 for ICC of 5% PFA fixed and 0.1/1% triton-X permeabilized cells and tissues.

• Applications: Immunohistochemistry, Immunofluorescence
• Primary Antibody Dilution: 1:500 for ICC for overnight incubation of 3D PFA fixed organoid tissue in 1xTBST with 5% donkey serum

Alessandro (Verified Customer) (12-09-2023)

good IF antibody. no unspecific staining

• Applications: Immunofluorescence