Product Information
25323-1-PBS targets CD32A/C in WB, Indirect ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag18123 Product name: Recombinant human FCGR2C protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 254-323 aa of BC137397 Sequence: ANSTDPVKAAQFEPPGRQMIAIRKRQPEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN Predict reactive species |
Full Name | Fc fragment of IgG, low affinity IIc, receptor for (CD32) |
Calculated Molecular Weight | 323 aa, 36 kDa |
Observed Molecular Weight | 40 kDa |
GenBank Accession Number | BC137397 |
Gene Symbol | CD32A/C |
Gene ID (NCBI) | 9103 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P31995 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
IgG Fc receptors (FcγRs) play important roles in immune responses. The low-affinity IgG Fc receptor, FcγRII (CD32), consists of a family of primarily cell membrane receptor proteins: CD32A, CD32B, and CD32C. They are encoded by the mRNA splice variants of three highly related genes: FCGR2A, FCGR2B, and FCGR2C (PMID: 30941127). CD32 is present on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes. This antibody raised against 254-323 aa of human CD32C (FCGR2C) can recognize both CD32A and CD32C forms.