CD34 Monoclonal antibody

CD34 Monoclonal Antibody for WB, IHC, IF-P, ELISA
Cat No. 60180-1-Ig
Clone No.3C8G12

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

WB, IHC, IF-P, ELISA

3C8G12, CD34 molecule

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman placenta tissue, human uterus tissue, human testis tissue
Positive IHC detected inhuman liver cancer tissue, human placenta tissue, human tonsillitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman placenta tissue, human tonsillitis tissue, human liver cancer tissue, human liver tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:2500-1:10000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60180-1-Ig targets CD34 in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag5996

Product name: Recombinant human CD34 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 34-287 aa of BC039146

Sequence: DNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYS

Predict reactive species
Full Name CD34 molecule
Calculated Molecular Weight 41 kDa
Observed Molecular Weight 105 kDa
GenBank Accession NumberBC039146
Gene Symbol CD34
Gene ID (NCBI) 947
RRIDAB_10733337
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP28906
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD34 is a 105- to 120-kDa glycophosphoprotein expressed on the majority of hematopoietic stem/progenitor cells, bone marrow stromal cells, capillary endothelial cells, embryonic fibroblasts, and some nerve tissue. CD34 is a commonly used marker for identifying human hematopoietic stem/progenitor cells and mediates cell adhesion and lymphocyte homing by binding L-selectin and E-selectin ligands. CD34 is also one of the best negative selection markers for characterizing and/or isolating human MSCs from bone marrow and other sources. Along with other positive selection markers (such as CD29, CD44, CD90, CD105 and CD166), negative selection markers (such as CD34 and CD45) are used for MSC identification. The calculated molecular mass of human CD34 is 41 kDa, various forms with different molecular weights may be produced due to different glycosylation patterns and alternative splicing (PMID: 24375067; 15750786).

Protocols

Product Specific Protocols
WB protocol for CD34 antibody 60180-1-IgDownload protocol
IHC protocol for CD34 antibody 60180-1-IgDownload protocol
IF protocol for CD34 antibody 60180-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIHC

Gastroenterology

Proteomic characterization identifies clinically relevant subgroups of gastrointestinal stromal tumors

Authors - Mingjun Sun
humanIF

Front Immunol

Thrombotic microangiopathy mediates poor prognosis among lupus nephritis via complement lectin and alternative pathway activation

Authors - Binshan Zhang
IHC

Front Bioeng Biotechnol

Primary Repair for Treating Acute Proximal Anterior Cruciate Ligament Tears: A Histological Analysis and Prospective Clinical Trial.

Authors - Yue Yang
human

Exp Cell Res

Nrf2 activation is involved in osteogenic differentiation of periodontal ligament stem cells under cyclic mechanical stretch.

Authors - Xun Xi
IHC

Biomed Mater

The additive effects of photobiomodulation and bioactive glasses on enhancing early angiogenesis.

Authors - Lidong Huang
humanIHC

Onco Targets Ther

Expression and significance of GRHL2 in esophageal cancer.

Authors - Chengcheng Shao

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Reyes (Verified Customer) (09-24-2025)

CD34 (in green) failed to mark specifically the blood vessels of the FFPE human brain cortex tissue. It seemed to mark some blood vessels, missing others. But it marked highly the background of the tissue.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Human Brain Cortex
CD34 Antibody Immunofluorescence validation (1:100 dilution) in Human Brain Cortex (Cat no:60180-1-Ig)
Loading...
||
New chat Able
正在加载,请稍候...