CD3EAP Polyclonal antibody, PBS Only

• 

  WB analysis using 31162-1-AP (same clone as 31162-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31162-1-AP (CD3EAP antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31162-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 31162-1-AP (same clone as 31162-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using CD3EAP antibody (31162-1-AP) at dilution of 1:500 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 31162-1-PBS in a different storage buffer formulation.

CD3EAP Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 31162-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

31162-1-PBS targets CD3EAP in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35074

  Product name: Recombinant human CD3EAP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-130 aa of BC038992

  Sequence: MEEPQAGDAARFSCPPNFTAKPPASESPRFSLEALTGPDTELWLIQAPADFAPECFNGRHVPLSGSQIVKGKLAGKRHRYRVLSSCPQAGEATLLAPSTEAGGGLTCASAPQGTLRILEGPQQSLSGSPL

• Full Name: CD3e molecule, epsilon associated protein
• Calculated Molecular Weight: 510 aa, 55 kDa
• Observed Molecular Weight: 80-90 kDa
• GenBank Accession Number: BC038992
• Gene Symbol: CD3EAP
• Gene ID (NCBI): 10849
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O15446
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Human RNA polymerase I (Pol I)-specific subunit, previously identified as ASE-1 and as CD3ɛ-associated signal transducer (CAST), CD3EAP is a 55 kDa nucleolar autoantigen that has an apparent molecular mass of 90 kDa (PMID: 11199923). CD3EAP/hPAF49 contains a single tyrosine residue at position 82 (Tyr82), which is phosphorylated upon stimulation of the T-cell receptor. Western blot analysis detected CD3EAP at an apparent molecular mass of ~80-90 kDa.