Product Information
83884-2-PBS targets CD40 Ligand/TNFSF5 as part of a matched antibody pair:
MP00845-1: 83884-1-PBS capture and 83884-2-PBS detection (validated in Cytometric bead array)
Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg0990 Product name: Recombinant Mouse CD40L/CD154 protein (His Tag) Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: N-His Domain: 115-260 aa of NM_011616.2 Sequence: GDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNLVMLENGKQLTVKREGLYYVYTQVTFCSNREPSSQRPFIVGLWLKPSSGSERILLKAANTHSSSQLCEQQSVHLGGVFELQAGASVFVNVTEASQVIHRVGFSSFGLLKL Predict reactive species |
| Full Name | CD40 ligand |
| Calculated Molecular Weight | 29 kDa |
| GenBank Accession Number | NM_011616.2 |
| Gene Symbol | CD154 |
| Gene ID (NCBI) | 21947 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P27548 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
