CD48 Polyclonal antibody, PBS Only

• 

  WB analysis using 27519-1-AP (same clone as 27519-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27519-1-AP (CD48 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27519-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Daudi using 27519-1-AP (same clone as 27519-1-PBS)

  Daudi cells were subjected to SDS PAGE followed by western blot with 27519-1-AP (CD48 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27519-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 27519-1-AP (same clone as 27519-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 27519-1-AP (CD48 antibody) at dilution of 1:2000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27519-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 27519-1-AP (same clone as 27519-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 27519-1-AP (CD48 antibody) at dilution of 1:2000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27519-1-PBS in a different storage buffer formulation.

CD48 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 27519-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

BLAST, BLAST1, B-lymphocyte activation marker BLAST-1, CD48 antigen, CD48 molecule

---

Product Information

27519-1-PBS targets CD48 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26536

  Product name: Recombinant human CD48 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 27-220 aa of BC016182

  Sequence: QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARS

• Full Name: CD48 molecule
• Calculated Molecular Weight: 43 kDa
• Observed Molecular Weight: 38-45 kDa
• GenBank Accession Number: BC016182
• Gene Symbol: CD48
• Gene ID (NCBI): 962
• RRID: AB_2880897
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P09326
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Signaling lymphocytic activation molecule family 2 (SLAMF2, CD48) is an adhesion and costimulatory molecule expressed constitutively on most hematopoietic cells, particularly in antigen-presenting cells (APC). CD48 is expressed on all the hematopoietic cells, both in humans and mice, except for murine neutrophils and long-term HSC. CD48 exists as both a membrane-bound (mCD48) and a soluble (sCD48) form. CD48 can activate T cells, antigen-presenting cells and granulocytes, by binding to CD2 or bacterial FimH, and through cell intrinsic effects. Interactions between CD48 and its high-affinity ligand CD244 are more complex, with both stimulatory and inhibitory outcomes. CD48 expression is increased in autoimmunity and allergy diseases, and anti-CD48 monoclonal antibodies have been shown to attenuate experimental autoimmune encephalomyelitis.