CD48 Recombinant monoclonal antibody, PBS Only

• 

  Affinity and Kinetic Characterization of 84186-2-PBS

  Biolayer interferometry (BLl) kinetic assays of 84186-2-PBS against Human CD48 were performed. The affinity constant is 2.31 nM.

CD48 Uni-rAb^® Recombinant Antibody for Indirect ELISA

Cat No. 84186-2-PBS

Clone No.241389E4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Indirect ELISA

Synonyms

BLAST, BLAST1, B-lymphocyte activation marker BLAST-1, CD48 antigen, CD48 molecule

---

Product Information

84186-2-PBS targets CD48 in Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1005

  Product name: Recombinant Human CD48 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 27-220 aa of BC016182

  Sequence: QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARS

• Full Name: CD48 molecule
• Calculated Molecular Weight: 43 kDa
• GenBank Accession Number: BC016182
• Gene Symbol: CD48
• Gene ID (NCBI): 962
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P09326
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.