Use Able AI chat for product recommendations

CD68 Monoclonal antibody

CD68 Monoclonal Antibody for IHC, IF-P, ELISA

Cat No. 66231-2-Ig
Clone No.3A9A7

Host / Isotype

Mouse / IgG1

Reactivity

human and More (1)

Applications

IHC, IF-P, ELISA

3A9A7, CD68 molecule, GP110, Macrosialin, SCARD1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 750
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inhuman tonsillitis tissue, human appendicitis tissue, human colon cancer tissue, human liver cancer tissue, human lung cancer tissue, human urothelial carcinoma tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman tonsillitis tissue

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:1000-1:6000
Immunofluorescence (IF)-PIF-P : 1:3000-1:12000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66231-2-Ig targets CD68 in IHC, IF-P, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag22815

Product name: Recombinant human CD68 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 29-319 aa of BC015557

Sequence: SATLLPSFTVTPTVTESTGTTSHRTTKSHKTTTHRTTTTGTTSHGPTTATHNPTTTSHGNVTVHPTSNSTATSQGPSTATHSPATTSHGNATVHPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYGHLSFGFMQDLQQKVVYLSYMAVEYNVSFPHAAQWTFSAQNASLRDLQAPLGQSFSCSNSSIILSPAVHLDLLSLRLQAAQLPHTGVFGQSFSCPSDRS

Predict reactive species
Full Name CD68 molecule
Calculated Molecular Weight 37 kDa
GenBank Accession NumberBC015557
Gene Symbol CD68
Gene ID (NCBI) 968
RRIDAB_2881622
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP34810
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD68 is a type I transmembrane glycoprotein that is highly expressed by human monocytes and tissue macrophages. It belongs to the lysosomal/endosomal-associated membrane glycoprotein (LAMP) family and primarily localizes to lysosomes and endosomes with a smaller fraction circulating to the cell surface. CD68 is also a member of the scavenger receptor family. It may play a role in phagocytic activities of tissue macrophages.

Protocols

Product Specific Protocols
IF protocol for CD68 antibody 66231-2-IgDownload protocol
IHC protocol for CD68 antibody 66231-2-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanIF

Cell Rep Med

Microneedle delivery of CAR-M-like engineered macrophages alleviates intervertebral disc degeneration through enhanced efferocytosis capacity

Authors - Xingyu Zhou
IHC

J Clin Invest

Lactate inhibits ATP6V0d2 expression in tumor-associated macrophages to promote HIF-2α-mediated tumor progression.

Authors - Na Liu
IF

Adv Healthc Mater

Wireless Electric Cues Mediate Autologous DPSC-Loaded Conductive Hydrogel Microspheres to Engineer The Immuno-Angiogenic Niche for Homologous Maxillofacial Bone Regeneration

Authors - Jiwei Sun

Redox Biol

Quercetin hinders microglial activation to alleviate neurotoxicity via the interplay between NLRP3 inflammasome and mitophagy.

Authors - Xiaojuan Han
IHC

Redox Biol

Redox-sensitive activation of CCL7 by BRG1 in hepatocytes during liver injury.

Authors - Ming Kong
humanIF

Transl Res

Purinergic receptor P2 × 7 contributes to abdominal aortic aneurysm development via modulating macrophage pyroptosis and inflammation

Authors - Likun Sun

Reviews

    5.0 out of 5
Add a review

2 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Cohen (Verified Customer) (06-02-2025)

Received a generous test sample of 20ul which stretched far. While the suggested dilutions ranged from 1/3000 to 12000, I found that 1/3000 was optimal for human adipose tissue and ectopic endometrial tissue. This is very impressive for a primary antibody, in my experience.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1/3000
  • Cell Tissue Type: Human adipose and ectopic endometrial tissue

Balawant (Verified Customer) (12-25-2023)

This excellent antibody has no background.

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: colon tissue
Loading...
||
New chat

Able

正在加载,请稍候...