CD81 Polyclonal antibody

• 

  WB analysis using 33170-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33170-1-AP (CD81 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse liver using 33170-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 33170-1-AP (CD81 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 33170-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 33170-1-AP (CD81 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse spleen using 33170-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 33170-1-AP (CD81 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse spleen using 33170-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 33170-1-AP (CD81 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CD81 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 33170-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IHC, ELISA

Synonyms

26 kDa cell surface protein TAPA-1, CD81 antigen, Tapa 1, Tapa1, Target of the antiproliferative antibody 1

---

Tested Applications

• Positive WB detected in: NIH/3T3 cells, mouse brain tissue
• Positive IHC detected in: mouse liver tissue, mouse spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33170-1-AP targets CD81 in WB, IHC, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg3833

  Product name: Recombinant Mouse CD81 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-N-rFc

  Tag: N-rFc

  Domain: 106-211 aa of NM_133655.2

  Sequence: VAAGIWGFVNKDQIAKDVKQFYDQALQQAVMDDDANNAKAVVKTFHETLNCCGSNALTTLTTTILRNSLCPSGGNILTPLLQQDCHQKIDELFSGKLYLIGIAAIV

• Full Name: CD81 antigen
• Calculated Molecular Weight: 26 kDa
• Observed Molecular Weight: 20-23 kDa
• GenBank Accession Number: NM_133655.2
• Gene Symbol: Cd81
• Gene ID (NCBI): 12520
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P35762
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD81 (also known as TAPA1 or TSPAN28) is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Many of these members are expressed on leukocytes and have been implicated in signal transduction, cell-cell interactions, and cellular activation and development. CD81 is involved in signal transduction and cell adhesion in the immune system (PMID: 9597125). CD81 has also been identified as en essential receptor for HCV (hepatitis C virus) (PMID: 21428934).