Product Information
84617-4-PBS targets CD82 in Indirect ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Eg1749 Product name: Recombinant Human CD82 protein (rFc Tag) (HPLC verified) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 111-228 aa of NM_002231.4 Sequence: GKLKQEMGGIVTELIRDYNSSREDSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNRPEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENL Predict reactive species |
Full Name | CD82 molecule |
Calculated Molecular Weight | 30 kDa |
GenBank Accession Number | NM_002231.4 |
Gene Symbol | CD82 |
Gene ID (NCBI) | 3732 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P27701-1 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |