Product Information
60744-3-PBS targets CD83 as part of a matched antibody pair:
MP51077-2: 60744-3-PBS capture and 60744-2-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag27435 Product name: Recombinant human CD83 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 22-144 aa of BC030830 Sequence: EVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAE Predict reactive species |
| Full Name | CD83 molecule |
| Calculated Molecular Weight | 205 aa, 23 kDa |
| GenBank Accession Number | BC030830 |
| Gene Symbol | CD83 |
| Gene ID (NCBI) | 9308 |
| ENSEMBL Gene ID | ENSG00000112149 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q01151 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
CD83 is a member of the immunoglobulin (Ig) superfamily, consisting of an extracellular V-type Ig-like domain, a transmembrane domain, and a cytoplasmic tail. CD83 is one of the most prominent markers for fully matured dendritic cells (DCs) (PMID: 17334966). It is also found on the surface of other activated hematopoietic cells, including lymphocytes, monocytes, macrophages, and neutrophils (PMID: 31231400; 17334966). CD83 regulates the maturation, activation, and homeostasis of numerous immune cells (PMID: 31231400; 32362900). CD83 can also expressed as a soluble form. Soluble CD83 can bind to DCs and inhibit their maturation (PMID: 17334966; 12403928).

