CD83 Monoclonal antibody, PBS Only (Capture)

CD83 Monoclonal Antibody for Cytometric bead array, Indirect ELISA
Cat No. 60744-3-PBS
Clone No.2G3A3

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60744-3-PBS targets CD83 as part of a matched antibody pair:

MP51077-2: 60744-3-PBS capture and 60744-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag27435

Product name: Recombinant human CD83 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 22-144 aa of BC030830

Sequence: EVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAE

Predict reactive species
Full Name CD83 molecule
Calculated Molecular Weight 205 aa, 23 kDa
GenBank Accession NumberBC030830
Gene Symbol CD83
Gene ID (NCBI) 9308
ENSEMBL Gene IDENSG00000112149
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ01151
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CD83 is a member of the immunoglobulin (Ig) superfamily, consisting of an extracellular V-type Ig-like domain, a transmembrane domain, and a cytoplasmic tail. CD83 is one of the most prominent markers for fully matured dendritic cells (DCs) (PMID: 17334966). It is also found on the surface of other activated hematopoietic cells, including lymphocytes, monocytes, macrophages, and neutrophils (PMID: 31231400; 17334966). CD83 regulates the maturation, activation, and homeostasis of numerous immune cells (PMID: 31231400; 32362900). CD83 can also expressed as a soluble form. Soluble CD83 can bind to DCs and inhibit their maturation (PMID: 17334966; 12403928).

Loading...
||
New chat Able
正在加载,请稍候...