Product Information
84796-1-PBS targets CD83 in Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg2033 Product name: Recombinant Human CD83 protein (rFc Tag) (HPLC verified) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 20-143 aa of NM_004233.4 Sequence: TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRA Predict reactive species |
| Full Name | CD83 molecule |
| Calculated Molecular Weight | 23 kDa |
| GenBank Accession Number | NM_004233.4 |
| Gene Symbol | CD83 |
| Gene ID (NCBI) | 9308 |
| ENSEMBL Gene ID | ENSG00000112149 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q01151 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
