CD83 Recombinant monoclonal antibody, PBS Only

• 

CD83 Uni-rAb^® Recombinant Antibody for Indirect ELISA

Cat No. 84796-1-PBS

Clone No.241855A1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Indirect ELISA

Synonyms

B cell activation protein, B-cell activation protein, BL11, CD83 antigen, CD83 molecule

---

Product Information

84796-1-PBS targets CD83 in Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2033

  Product name: Recombinant Human CD83 protein (rFc Tag) (HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 20-143 aa of NM_004233.4

  Sequence: TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRA

• Full Name: CD83 molecule
• Calculated Molecular Weight: 23 kDa
• GenBank Accession Number: NM_004233.4
• Gene Symbol: CD83
• Gene ID (NCBI): 9308
• ENSEMBL Gene ID: ENSG00000112149
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q01151
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.