CD8b Monoclonal antibody

• 

  IHC staining of human breast cancer using 68432-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 68432-1-Ig (CD8b antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 68432-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 68432-1-Ig (CD8b antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CD8b Monoclonal Antibody for IHC, ELISA

Cat No. 68432-1-Ig

Clone No.4B3B8

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IHC, ELISA

Synonyms

CD8, 4B3B8, Ly3, Leu2, CD8B1

---

Tested Applications

• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

68432-1-Ig targets CD8b in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16925

  Product name: Recombinant human CD8B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 22-171 aa of BC100913

  Sequence: LQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSPI

• Full Name: CD8b molecule
• Calculated Molecular Weight: 243 aa, 27 kDa
• GenBank Accession Number: BC100913
• Gene Symbol: CD8B
• Gene ID (NCBI): 926
• RRID: AB_3085146
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P10966
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD8b (T-cell surface glycoprotein CD8 beta chain) is an integral membrane glycoprotein that forms disulfide-linked heterodimers with CD8a (CD8 alpha chain). The CD8 alpha/beta heterodimer is the predominant CD8 complex expressed on the cell surface (PMID: 1534146; 2111591). CD8 is a transmembrane glycoprotein predominantly expressed on cytotoxic T cells and can also be found on natural killer cells, cortical thymocytes, and dendritic cells. CD8 serves as a co-receptor for the T cell receptor (TCR). Both CD8 and TCR recognize antigens displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. CD8 plays a role in T cell development and activation of mature T cells.