Anti-Mouse CD9 Rabbit Recombinant Antibody, PBS Only

• 

  FC experiment of mouse bone marrow cells using 98270-1-RR (same clone as 98270-1-PBS)

  1x10^6 mouse bone marrow cells were surface stained with 0.25 ug Anti-Mouse CD9 Rabbit Recombinant Antibody (98270-1-RR, Clone: 242432C7) or 0.25 ug Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were co-stained with APC Anti-Mouse Ly-6G/Ly-6C (Gr-1). Cells were not fixed. This data was developed using the same antibody clone with 98270-1-PBS in a different storage buffer formulation.

• 

  FC experiment of mouse bone marrow cells using 98270-1-RR (same clone as 98270-1-PBS)

  1x10^6 mouse bone marrow cells were surface stained with 0.25 ug Anti-Mouse CD9 Rabbit Recombinant Antibody (98270-1-RR, Clone: 242432C7)(red) or 0.25 ug Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed. This data was developed using the same antibody clone with 98270-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 98270-1-RR

  Biolayer interferometry (BLl) kinetic assays of 98270-1-RR against Mouse CD9 were performed. The affinity constant is 0.26 nM.

CD9 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98270-1-PBS

Clone No.242432C7

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

242432C7, CD9 antigen, MIC3, P24, Tspan 29

---

Product Information

98270-1-PBS targets CD9 in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1397

  Product name: Recombinant Mouse CD9 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 110-193 aa of NM_007657.3

  Sequence: THKDEVIKELQEFYKDTYQKLRSKDEPQRETLKAIHMALDCCGIAGPLEQFISDTCPKKQLLESFQVKPCPEAISEVFNNKFHI

• Full Name: CD9 antigen
• Calculated Molecular Weight: 25 kDa
• GenBank Accession Number: NM_007657.3
• Gene Symbol: Cd9
• Gene ID (NCBI): 12527
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P40240
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The cell-surface molecule CD9, a member of the transmembrane-4 superfamily, interacts with the integrin family and other membrane proteins, and is postulated to participate in cell migration and adhesion. Expression of CD9 enhances membrane fusion between muscle cells and promotes viral infection in some cells (PMID:10459022). It is often used as a mesenchymal stem cell marker (PMID:18005405).