CD90 Monoclonal antibody

CD90 Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 66766-1-Ig
Clone No.2D7D11

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, pig, rabbit and More (1)

Applications

WB, IHC, IF-P, ELISA

CD90 / Thy1, THY1, 2D7D11, Thy 1 antigen, Thy 1 cell surface antigen

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected infetal human brain tissue, rabbit brain tissue, U2OS cells, human kidney tissue, pig brain tissue, pig spleen tissue, pig colon tissue
Positive IHC detected inhuman tonsillitis tissue, human colon cancer tissue, human gliomas tissue, human lung cancer tissue, mouse liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman tonsillitis tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66766-1-Ig targets CD90 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

Tested Reactivity human, mouse, rat, pig, rabbit
Cited Reactivityhuman, mouse, rat, pig, rabbit, bovine
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag25603

Product name: Recombinant human CD90 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 20-80 aa of BC065559

Sequence: QKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNF

Predict reactive species
Full Name Thy-1 cell surface antigen
Calculated Molecular Weight 161 aa, 18 kDa
Observed Molecular Weight 28 kDa
GenBank Accession NumberBC065559
Gene Symbol CD90/Thy1
Gene ID (NCBI) 7070
RRIDAB_2882112
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP04216
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD90, also known as THY1, is a 25-35 kD protein that is expressed on 1-4% of human fetal liver cells, cord blood cells, and bone marrow cells. CD90 is one of the essential surface molecules expressed on human MSC from bone marrow and other sources. Activation of Thy-1 has been reported to promote T cell activation. It also affects numerous nonimmunologic biological processes, including cellular adhesion, neurite outgrowth, tumor growth, migration, and cell death.

Protocols

Product Specific Protocols
WB protocol for CD90 antibody 66766-1-IgDownload protocol
IHC protocol for CD90 antibody 66766-1-IgDownload protocol
IF protocol for CD90 antibody 66766-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Cell Mol Biol Lett

Reciprocal negative feedback between Prrx1 and miR-140-3p regulates rapid chondrogenesis in the regenerating antler

Authors - Pengfei Hu
pigIF

Int J Biol Macromol

A light-cured injectable composite hydrogel based on chitosan and decellularized matrix modulates stem cell aggregation behavior for accelerating cartilage defect repair

Authors - Peipei Feng
humanWB

J Mol Cell Biol

Cancer-associated adipocytes-derived G-CSF promotes breast cancer malignancy via Stat3 signaling.

Authors - Li Liu
humanIHC

Int J Mol Sci

Expression of Cancer Stem Cell Markers EpCAM and CD90 Is Correlated with Anti- and Pro-Oncogenic EphA2 Signaling in Hepatocellular Carcinoma.

Authors - Nobuhiko Asakura
mouseIF

Inflamm Bowel Dis

Stromal Cell Subsets Show Model-Dependent Changes in Experimental Colitis and Affect Epithelial Tissue Repair and Immune Cell Activation

Authors - Zhou Zhou
humanFC

Int J Biol Sci

Cancer-associated adipocytes promote the invasion and metastasis in breast cancer through LIF/CXCLs positive feedback loop.

Authors - Chong Zhou
Loading...
||
New chat Able
正在加载,请稍候...