Anti-Human CD93 Rabbit Recombinant Antibody

• 

  FC experiment of human PBMCs using 98337-1-RR

  1x10^6 human PBMCs were surface stained with 0.25 ug Anti-Human CD93 Rabbit RecAb (98337-1-RR, Clone: 242464E6) or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were then stained with CoraLite® Plus 647 Anti-Human CD14. Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed.

• 

  FC experiment of human PBMCs using 98337-1-RR

  1x10^6 human PBMCs were surface stained with 0.25 ug Anti-Human CD93 Rabbit RecAb (98337-1-RR, Clone: 242464E6) (red) or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed.

CD93 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98337-1-RR

Clone No.242464E6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

C1QR1, 242464E6, C1qR, C1qR(p), C1qRp

---

Tested Applications

• Positive FC detected in: human PBMCs

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98337-1-RR targets CD93 in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2794

  Product name: Recombinant Human CD93 protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 24-580 aa of NM_012072.3

  Sequence: ADTEAVVCVGTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQHVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPSRLPKWSEGPCGSPGSPGSNIEGFVCKFSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAANVACGEGDKDETQSHYFLCKEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSFLCGCRPGFRLLDDLVTCASRNPCSSSPCRGGATCVLGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQDSPCAQECVNTPGGFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTDGSFHCSCEEGYVLAGEDGTQCQDVDECVGPGGPLCDSLCFNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPSGPPDEEDKGEKEGSTVPRAATASPTRGPEGTPKATPTTSRPSLSSDAPITSAPLKMLAPSGSPGVWREPSIHHATAASGPQEPAGGDSSVATQNNDGTDGQK

• Full Name: CD93 molecule
• Calculated Molecular Weight: 69 kDa
• GenBank Accession Number: NM_012072.3
• Gene Symbol: CD93
• Gene ID (NCBI): 22918
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NPY3
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

CD93, also known as C1qR or C1qR(p), is a single-pass type I transmembrane glycoprotein and a member of the group 14 of the C-type lectin-like domain (CTLD) superfamily, which also includes endosialin/CD248, thrombomodulin, and CLEC14A (PMID: 31287944). CD93 consists of a C-type lectin-like domain, five EGF-like repeats, a mucin-like domain, a transmembrane domain and a cytoplasmic domain (PMID: 28912033). CD93 is mainly expressed on endothelial cells and has been reported to be expressed by neurons and various cells of the hematopoietic system, including monocytes, neutrophils, B cells, natural killer cells, platelets and hematopoietic stem cells (PMID: 37443812). CD93 plays a role in various physiological processes including angiogenesis, inflammation, and cell adhesion (PMID: 31287944).